Name : rplY (t0630) Accession : NP_804482.1 Strain : Salmonella enterica Ty2 Genome accession: NC_004631 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L25 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG1825 EC number : - Position : 711610 - 711894 bp Length : 285 bp Strand : - Note : 'the Ctc family of proteins consists of two types, one that contains the N-terminal ribosomal protein L25 domain only which in Escherichia coli binds the 5S rRNA while a subset of proteins contain a C-terminal extension that is involved in the stress resp DNA sequence : ATGTTTACTATCAACGCAGAAGTACGTAAAGAGCAGGGTAAGGGTGCGAGCCGCCGCCTGCGCGCCGCTAACAAGTTCCC GGCAATCATCTACGGCGGTTCTGAAGCCCCGATTGCTATCGAACTGGACCACGACCAGGTGATGAACATGCAAGCTAAAG CTGAATTCTACAGCGAAGTTCTGACCCTCGTTGTTGACGGTAAAGAAGTAAAAGTTAAAGCTCAGGCTGTACAGCGTCAC GCTTACAAACCGAAGCTGACTCACATCGACTTCGTTCGCGCGTAA Protein sequence : MFTINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEVKVKAQAVQRH AYKPKLTHIDFVRA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ESA_01051 | YP_001437155.1 | 50S ribosomal protein L25 | Not tested | Not named | Protein | 7e-37 | 89 |