
|
Name : EF2991 (EF2991) Accession : NP_816608.1 Strain : Enterococcus faecalis V583 Genome accession: NC_004668 Putative virulence/resistance : Resistance Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG1937 EC number : - Position : 2864633 - 2864893 bp Length : 261 bp Strand : + Note : similar to GP:5360840; identified by sequence similarity DNA sequence : ATGACTGAAGAAAAAAAGAAAGTGCTGAATCGTTTACGCCGCACAGAAGGTCAAATTCGCGGGATTCAAAAAATGATTGA TGAAGAAAAAGAATGTATCGATGTTATCACTCAGTTGAGTGCGGTCCGTTCTAGTATTGATCGCGTAATGGGGATGATAG TTGCGGAGAATTTAAAGCATTGCTTTGAAAATCCTGAAAAAGATCCTAAAGAACAAGAAGAGCGATTAGCACAAGCGATT AATATGATTGTCAAAAAGTAA Protein sequence : MTEEKKKVLNRLRRTEGQIRGIQKMIDEEKECIDVITQLSAVRSSIDRVMGMIVAENLKHCFENPEKDPKEQEERLAQAI NMIVKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | BAA82170.2 | - | Not tested | Type-II SCCmec | Protein | 6e-14 | 47 |
| unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 2e-15 | 47 |
| SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 3e-15 | 47 |
| unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 2e-15 | 47 |
| SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 3e-15 | 47 |
| SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 3e-15 | 47 |
| unnamed | BAA86632.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 3e-14 | 47 |
| unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-15 | 47 |
| SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 3e-15 | 47 |
| SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 9e-15 | 44 |
| unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 6e-14 | 43 |
| unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 6e-14 | 43 |
| SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 1e-14 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| EF2991 | NP_816608.1 | hypothetical protein | BAC0333 | Protein | 3e-12 | 42 |