Gene Information

Name : BC5463 (BC5463)
Accession : NP_835122.1
Strain : Bacillus cereus ATCC 14579
Genome accession: NC_004722
Putative virulence/resistance : Virulence
Product : two-component response regulator yycF
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5390072 - 5390779 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGATGGGAAAGAAAATTTTAGTAGTTGATGATGAAAAGCCGATTGCAGATATTTTGAAGTTTAACCTAGAAAAAGAAGG
TTTTGAAATAGTAATGGCGCATGATGGTGATGAAGCAATTGAAAAGGCTAATGAAGAGCAACCAGATATGGTTTTATTAG
ATATTATGCTACCAGGTAAAGATGGCTTAGAGGTTTGCCGTGAAATACGTAAAAGCTCAGAAATGCCGATTATTATGCTT
ACAGCAAAGGACTCTGAGATTGATAAAGTATTAGGGCTCGAGCTTGGGGCAGATGATTATGTAACGAAGCCATTTAGTAC
GAGGGAATTACTTGCTCGTGTGAAGGCGAATTTACGCCGCCATCAACAAGGTGGTGCTGCGGAAAAAGAAGAAAATACAG
AAATGGTTATTGGACCAATTGTGATTAATCCAAATGCATATAGTGTAACGAAGCGCGAGGAAAATATCGAGCTTACACAT
CGTGAATTTGAGTTGCTACATTATTTAGCGAAACATTTAGGACAAGTTATGACACGCGAACATTTATTACAAACAGTTTG
GGGTTATGACTATTTTGGAGATGTGCGCACAGTAGACGTTACAGTACGTCGTTTGCGTGAAAAAATTGAAGATAATCCAA
GCCATCCTACTTTAATTGTAACTAGACGTGGAGTAGGGTATTACTTGCGTGACCCAGAGCAGGAATAG

Protein sequence :
MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKDGLEVCREIRKSSEMPIIML
TAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQGGAAEKEENTEMVIGPIVINPNAYSVTKREENIELTH
REFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTLIVTRRGVGYYLRDPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-38 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC5463 NP_835122.1 two-component response regulator yycF NC_012469.1.7685629. Protein 2e-64 67
BC5463 NP_835122.1 two-component response regulator yycF NC_002952.2859905.p0 Protein 4e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_007622.3794472.p0 Protein 2e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_002745.1124361.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_009782.5559369.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_002951.3237708.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_003923.1003749.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_002758.1121668.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_009641.5332272.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_013450.8614421.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF NC_007793.3914279.p0 Protein 3e-57 56
BC5463 NP_835122.1 two-component response regulator yycF HE999704.1.gene2815. Protein 5e-48 51
BC5463 NP_835122.1 two-component response regulator yycF NC_012469.1.7686381. Protein 2e-45 50
BC5463 NP_835122.1 two-component response regulator yycF AE016830.1.gene1681. Protein 2e-48 48
BC5463 NP_835122.1 two-component response regulator yycF CP004022.1.gene3215. Protein 1e-35 48
BC5463 NP_835122.1 two-component response regulator yycF AE000516.2.gene3505. Protein 4e-39 46
BC5463 NP_835122.1 two-component response regulator yycF HE999704.1.gene1528. Protein 7e-32 45
BC5463 NP_835122.1 two-component response regulator yycF AF155139.2.orf0.gene Protein 6e-39 45
BC5463 NP_835122.1 two-component response regulator yycF FJ349556.1.orf0.gene Protein 5e-40 45
BC5463 NP_835122.1 two-component response regulator yycF CP000647.1.gene4257. Protein 9e-33 44
BC5463 NP_835122.1 two-component response regulator yycF CP001138.1.gene4273. Protein 8e-33 44
BC5463 NP_835122.1 two-component response regulator yycF CP000034.1.gene3834. Protein 8e-34 44
BC5463 NP_835122.1 two-component response regulator yycF BAC0533 Protein 9e-33 44
BC5463 NP_835122.1 two-component response regulator yycF NC_002695.1.915041.p Protein 8e-34 44
BC5463 NP_835122.1 two-component response regulator yycF AF162694.1.orf4.gene Protein 2e-34 43
BC5463 NP_835122.1 two-component response regulator yycF AM180355.1.gene1830. Protein 1e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_003923.1003417.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_013450.8614146.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_002951.3238224.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_007793.3914065.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_002758.1121390.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_010079.5776364.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_002952.2859858.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF NC_007622.3794948.p0 Protein 8e-37 43
BC5463 NP_835122.1 two-component response regulator yycF BAC0125 Protein 1e-31 42
BC5463 NP_835122.1 two-component response regulator yycF DQ212986.1.gene4.p01 Protein 2e-36 42
BC5463 NP_835122.1 two-component response regulator yycF CP004022.1.gene1676. Protein 8e-32 42
BC5463 NP_835122.1 two-component response regulator yycF AF130997.1.orf0.gene Protein 6e-35 41
BC5463 NP_835122.1 two-component response regulator yycF NC_014475.1.orf0.gen Protein 3e-39 41
BC5463 NP_835122.1 two-component response regulator yycF NC_005054.2598277.p0 Protein 3e-39 41
BC5463 NP_835122.1 two-component response regulator yycF AE015929.1.gene1106. Protein 3e-32 41
BC5463 NP_835122.1 two-component response regulator yycF NC_010410.6002989.p0 Protein 2e-32 41
BC5463 NP_835122.1 two-component response regulator yycF NC_011595.7057856.p0 Protein 2e-32 41
BC5463 NP_835122.1 two-component response regulator yycF NC_010400.5986590.p0 Protein 1e-31 41
BC5463 NP_835122.1 two-component response regulator yycF BAC0039 Protein 7e-34 41
BC5463 NP_835122.1 two-component response regulator yycF CP000034.1.gene2186. Protein 7e-34 41
BC5463 NP_835122.1 two-component response regulator yycF NC_002695.1.916589.p Protein 6e-34 41
BC5463 NP_835122.1 two-component response regulator yycF CP001918.1.gene3444. Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC5463 NP_835122.1 two-component response regulator yycF VFG1563 Protein 6e-38 43
BC5463 NP_835122.1 two-component response regulator yycF VFG1702 Protein 1e-37 43
BC5463 NP_835122.1 two-component response regulator yycF VFG1390 Protein 1e-38 42
BC5463 NP_835122.1 two-component response regulator yycF VFG1386 Protein 4e-35 42
BC5463 NP_835122.1 two-component response regulator yycF VFG1389 Protein 6e-31 42