Gene Information

Name : yedW (S2113)
Accession : NP_837578.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2016943 - 2017614 bp
Length : 672 bp
Strand : -
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAACGCAGGGGCTTTCCGAAGCGGGTTATGTCAT
TGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGATGATTATGCATTGATCATTCTGGATATTATGC
TTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACGGCAAAGCAAACCCCTGTTATTTGCCTTACTGCAAGG
GATTCTGTCGATGACAGAGTCAGAGGGTTGGACAGTGGGGCAAATGATTATCTGGTAAAACCTTTTTCATTTTCTGAGTT
GCTAGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTCTGAATTCAACATTAGAAATCAGTGGCTTAAAAATGGACT
CTGTCAGTCAAAGTGTCAGCAGGGACAATATCAGTATTACACTGACGCGCAAGGAGTTTCAGTTACTTTGGCTACTGGCC
TCCAGAGCTGGCGAGATTATACCCAGAACGGTTATTGCGAGTGAAATTTGGGGAATCAACTTTGATAGTGATACCAATAC
GGTGGATGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTTCCTGAAAAGCTAATCGCCACAATCCGGGGGA
TGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTAR
DSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNSTLEISGLKMDSVSQSVSRDNISITLTRKEFQLLWLLA
SRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-81 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-80 76

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0125 Protein 4e-59 57
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0197 Protein 2e-56 56
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0083 Protein 3e-54 54
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0308 Protein 2e-52 53
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0111 Protein 6e-56 52
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0638 Protein 4e-49 52
yedW NP_837578.1 transcriptional regulatory protein YedW BAC0347 Protein 3e-50 49
yedW NP_837578.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 2e-33 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 1e-38 42
yedW NP_837578.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 1e-38 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW NP_837578.1 transcriptional regulatory protein YedW VFG0596 Protein 3e-81 77