Gene Information

Name : yeeV (S3204)
Accession : NP_838487.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3087941 - 3088318 bp
Length : 378 bp
Strand : +
Note : residues 1 to 124 of 125 are 85.48 pct identical to residues 1 to 124 of 124 from Escherichia coli K-12 : B2005

DNA sequence :
ATGAATACATTACCCGACACTCACGTACGGGAGGCATCGGGCTGCCCGTCTCCCATCACCATCTGGCAGACACTGCTCAC
CCGACTGCTGGACCAGCACTATGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGAATTTCACTGTGTGACGCGGTGAACTTTCTCGTTGAAAAATACGCGCTGGTACGTACCGACCAGCCGGGATTC
AGCGCAGGAGCCCCGTCGCAGTTAATCAACAGCATTGATATTCTCCGGGCACGCCGGGCAACCGGCCTGATGACCCGCGA
TAACTACAGAACGGTAAATAACATTACCCGGGGGAAGCATCCGGAAGCGAAACAATGA

Protein sequence :
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 3e-55 100
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 4e-55 100
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 4e-55 100
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 4e-54 97
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 4e-53 97
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 5e-50 94
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-51 94
unnamed AAC31486.1 L0007 Not tested LEE Protein 4e-50 94
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 4e-50 94
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 5e-50 94
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 1e-50 93
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-51 93
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 1e-50 92
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-50 92
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-49 92
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 3e-50 92
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-48 92
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 6e-50 91
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 6e-50 91
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 7e-49 90
unnamed AAL08478.1 unknown Not tested SRL Protein 2e-48 90
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-49 89

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeV NP_838487.1 hypothetical protein VFG0663 Protein 1e-55 100
yeeV NP_838487.1 hypothetical protein VFG0786 Protein 2e-50 94
yeeV NP_838487.1 hypothetical protein VFG1682 Protein 4e-51 93
yeeV NP_838487.1 hypothetical protein VFG1530 Protein 5e-49 92
yeeV NP_838487.1 hypothetical protein VFG1620 Protein 1e-50 92
yeeV NP_838487.1 hypothetical protein VFG1069 Protein 8e-49 90