Gene Information

Name : S0382 (S0382)
Accession : NP_836104.1
Strain : Shigella flexneri 2457T
Genome accession: NC_004741
Putative virulence/resistance : Unknown
Product : ISSfl3 orfB
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 385582 - 385929 bp
Length : 348 bp
Strand : -
Note : residues 1 to 115 of 115 are 100.00 pct identical to residues 1 to 115 of 115 from GenPept : >gb|AAL72465.1| (AF386526) hypothetical protein [Shigella flexneri 2a]

DNA sequence :
ATGATAACGCTGCCGACCGGTACCAAAATCTGGATCATCGCTGGCATCACAGATATGCGTTGTGGCTTCAATGGCCTAGC
TTCGAAGGTGCAGAACACGCTGAAAGATGACCCGTTCTCCGGGCATATCTTCGTCTTCCGGGGCCGCAGTGGCAAAATGG
TGAAAATACTGTGGGCCGATCGTGACGGGTTATGCCTGTTCGCCAAACGCCTGGAACGGGGCCGCTTCGTCTGGCCGGTG
ACCCGGGAAGGGAAAGTGCACCTGACGCCAGCTCAGTTATCCATGCTACTGGAGGGGATCGCGTGGCCACATCCCAAACG
GACAGAACGGCCTGGCATCCGGATATAA

Protein sequence :
MITLPTGTKIWIIAGITDMRCGFNGLASKVQNTLKDDPFSGHIFVFRGRSGKMVKILWADRDGLCLFAKRLERGRFVWPV
TREGKVHLTPAQLSMLLEGIAWPHPKRTERPGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-50 98
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-50 98
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-45 82
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-45 82
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-44 81
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-37 74
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-37 74
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-36 73
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-37 73
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-37 73
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-37 73
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-37 73
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-37 73
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-37 73
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-37 73
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-37 73
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-37 73
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-36 73
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-28 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-31 63
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-33 62
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-33 62
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-34 61
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-34 61
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-34 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S0382 NP_836104.1 ISSfl3 orfB VFG1665 Protein 5e-45 81
S0382 NP_836104.1 ISSfl3 orfB VFG1698 Protein 3e-38 74
S0382 NP_836104.1 ISSfl3 orfB VFG0792 Protein 1e-37 73
S0382 NP_836104.1 ISSfl3 orfB VFG1052 Protein 2e-37 73
S0382 NP_836104.1 ISSfl3 orfB VFG1709 Protein 1e-37 73
S0382 NP_836104.1 ISSfl3 orfB VFG1517 Protein 5e-29 72
S0382 NP_836104.1 ISSfl3 orfB VFG1737 Protein 4e-35 60