Gene Information

Name : NE0749 (NE0749)
Accession : NP_840825.1
Strain : Nitrosomonas europaea ATCC 19718
Genome accession: NC_004757
Putative virulence/resistance : Unknown
Product : transposase IS911
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 811455 - 811787 bp
Length : 333 bp
Strand : -
Note : -

DNA sequence :
ATGAATAAACAAAACAAGCAAAACAAGTTTTCCCCTGAAGTTCGTGAACGATCTGTTCGTCTGGTACAGGAACATCGAGG
CGAATATCCATCGCTATGGGCGGCGGTTGAATCAATTGCACCCAAGATTGGCTGTGTGCCCTCCACGTTGCTGGAATGGG
TTAAACGTAGCGAAATTAACAATGGCGCACGCGAAGGTCTGACAAGCAGTGAACGTGATCGCCTCAAGGCGTTGGAGCGT
GAGAACAGGGAACTGCGCCGAGCCAATGAGATATTGAAAACAGCCAGTGCTTTTTTCGCCCAGGCGGAGCTCGACCGCGT
TCTGAAGAAGTAA

Protein sequence :
MNKQNKQNKFSPEVRERSVRLVQEHRGEYPSLWAAVESIAPKIGCVPSTLLEWVKRSEINNGAREGLTSSERDRLKALER
ENRELRRANEILKTASAFFAQAELDRVLKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 5e-20 62
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 5e-20 62
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 5e-20 62
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 5e-20 62
unnamed AAF09023.1 unknown Not tested SHI-O Protein 9e-17 61
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 9e-17 61
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-17 61
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-17 61
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 1e-17 61
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 4e-16 61
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-16 60
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 9e-17 60
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 1e-19 60
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 1e-19 60
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 5e-15 60
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 1e-19 60
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-15 60
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-15 60
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-19 60
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-16 60
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 1e-19 60
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-16 60
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-16 60
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-16 60
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-16 60
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-14 58
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-14 58
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 3e-14 58
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 4e-14 58
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 3e-14 58
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 2e-07 43
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 2e-06 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NE0749 NP_840825.1 transposase IS911 VFG1603 Protein 1e-16 61
NE0749 NP_840825.1 transposase IS911 VFG0606 Protein 3e-17 60
NE0749 NP_840825.1 transposase IS911 VFG0643 Protein 9e-17 60
NE0749 NP_840825.1 transposase IS911 VFG1717 Protein 1e-14 58