Gene Information

Name : Pro1780 (Pro1780)
Accession : NP_876171.1
Strain : Prochlorococcus marinus CCMP1375
Genome accession: NC_005042
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1633934 - 1634743 bp
Length : 810 bp
Strand : -
Note : CheY-like receiver domain and a wHTH DNA-binding domain

DNA sequence :
ATGTATGAAGAAGGTTCATCCATGCTTGAGAAGAGCAATGATGGGCCCGGTTCAAAACCTGCCTCTCTCCCTTCTGCCAC
AATTTTAGTTGTTGATGATGAACCAGCAGTTTTAAAAGTCTTGGTTACCAGGCTTGAGTTAGCAGGCTATAAAGTTGTTT
CAGCTTCAGATGGTGAAGAGGCTTTAGATGTTTTTCATAGGGAAATTCCTGATCTTGTCGTTCTTGATGTAATGCTTCCT
AAGCTTGATGGCTTTGCTGTATGTAGGAGATTGCGAGCTGAATCAATTGTCCCGATTATTTTTCTTAGTGCTCTTGAAGC
AATATCTGAGCGAGTAGCGGGACTTGACTTGGGTGCTGATGATTATTTATCTAAACCGTTTAGTCCAAAAGAGCTTGAAG
CACGTATAGCCACAATATTGCGTAGAATGGGTCCTGGCGCGTCTGTAGCTGAACCTAGAGAGATTCCTGCTGGGCAAGGT
GTGATGAAACTAGGTGAATTAGTTGTGGATACAAATCGTCGTCAGGTTAGTCGCGGTGGAGAAAGGATTGGTTTAACTTA
CACAGAGTTTAGTTTGCTTGAATTACTGTTTCGTGACCCTGGGAAAGTAGTTCCTAGAGCAGAGATACTTGAGCAGCTAT
GGGGATATCCTCCTAGGCGTGCTGCTGACTTAAGAGTTGTTGACGTTTATGTAGCACGTTTGCGAGGCAAGCTTGAGCCA
GATCCTCGTAATCCGGAGTTAATTCTTACTGTAAGAGGCATAGGTTATTCATCTCAGAGGTTGAATGAGTTTCCTCCTGT
TAGCTCTTAA

Protein sequence :
MYEEGSSMLEKSNDGPGSKPASLPSATILVVDDEPAVLKVLVTRLELAGYKVVSASDGEEALDVFHREIPDLVVLDVMLP
KLDGFAVCRRLRAESIVPIIFLSALEAISERVAGLDLGADDYLSKPFSPKELEARIATILRRMGPGASVAEPREIPAGQG
VMKLGELVVDTNRRQVSRGGERIGLTYTEFSLLELLFRDPGKVVPRAEILEQLWGYPPRRAADLRVVDVYVARLRGKLEP
DPRNPELILTVRGIGYSSQRLNEFPPVSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pro1780 NP_876171.1 two-component response regulator NC_002952.2859905.p0 Protein 5e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_007622.3794472.p0 Protein 5e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-42 45
Pro1780 NP_876171.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-42 44
Pro1780 NP_876171.1 two-component response regulator BAC0638 Protein 3e-26 44
Pro1780 NP_876171.1 two-component response regulator AE000516.2.gene3505. Protein 1e-37 44
Pro1780 NP_876171.1 two-component response regulator BAC0111 Protein 4e-33 43
Pro1780 NP_876171.1 two-component response regulator BAC0083 Protein 2e-33 43
Pro1780 NP_876171.1 two-component response regulator NC_012469.1.7685629. Protein 3e-39 43
Pro1780 NP_876171.1 two-component response regulator BAC0125 Protein 5e-34 42
Pro1780 NP_876171.1 two-component response regulator BAC0197 Protein 2e-32 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pro1780 NP_876171.1 two-component response regulator VFG1390 Protein 4e-42 48
Pro1780 NP_876171.1 two-component response regulator VFG1389 Protein 1e-29 43