Gene Information

Name : rpaB (SYNW2246)
Accession : NP_898335.1
Strain : Synechococcus sp. WH 8102
Genome accession: NC_005070
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2146350 - 2147096 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGACGGCCACGACCCCCTCCAAGGAAACAATCCTCGTGGTCGATGACGAGGCCTCGATCCGACGGATTCTGGAAACCCG
CTTGTCGATGATCGGGTACAACGTCGTCACGGCCTGCGACGGCACCGAAGCGCTCGAGCTGTTCGAAAACACGGCTCCAG
ATCTGGTGGTGCTCGACGTGATGATGCCGAAGCTGGACGGCTACGGCGTCTGCCAGGAGCTGCGCAAGGAATCCGATGTG
CCGATCGTGATGCTGACGGCCCTCGGCGATGTGGCGGACCGGATCACGGGTCTTGAGCTCGGGGCCGATGACTACGTCGT
CAAACCGTTCAGCCCAAAGGAGCTGGAAGCCCGCATCCGTTGCGTGCTGCGTCGGGTGGAGAAGGAATCCGTGGCTGGCA
TCCCCAACTCGGGGGTGATTCAGGTGTCGGATCTCCGCATCGACACCAACAAACGCCAGGTGTTCCGGGCCGACGAGCGG
ATCCGACTGACCGGGATGGAATTCAGCCTGCTGGAATTGCTGGTGAGTCGCTCCGGTGAGCCATTCAATCGGGGAGAAAT
TCTCAAGGAAGTCTGGGGATACACCCCGGAACGCCATGTGGACACCCGCGTGGTGGATGTCCACATTTCGCGGCTTCGCT
CCAAGTTGGAGGATGATCCTGCTAACCCCGAGTTGATCCTCACGGCTCGCGGTACCGGCTACCTGTTCCAGCGCATCATC
GACTCCGTTGCCTCCGAAGGACCCTGA

Protein sequence :
MTATTPSKETILVVDDEASIRRILETRLSMIGYNVVTACDGTEALELFENTAPDLVVLDVMMPKLDGYGVCQELRKESDV
PIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRRVEKESVAGIPNSGVIQVSDLRIDTNKRQVFRADER
IRLTGMEFSLLELLVSRSGEPFNRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLFQRII
DSVASEGP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rpaB NP_898335.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-45 49
rpaB NP_898335.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-45 48
rpaB NP_898335.1 two-component response regulator BAC0125 Protein 2e-39 47
rpaB NP_898335.1 two-component response regulator NC_012469.1.7685629. Protein 3e-43 47
rpaB NP_898335.1 two-component response regulator AE000516.2.gene3505. Protein 2e-40 47
rpaB NP_898335.1 two-component response regulator HE999704.1.gene2815. Protein 2e-41 46
rpaB NP_898335.1 two-component response regulator BAC0083 Protein 2e-35 43
rpaB NP_898335.1 two-component response regulator BAC0197 Protein 9e-35 43
rpaB NP_898335.1 two-component response regulator BAC0638 Protein 4e-28 43
rpaB NP_898335.1 two-component response regulator CP000034.1.gene3671. Protein 8e-39 43
rpaB NP_898335.1 two-component response regulator HE999704.1.gene1528. Protein 1e-30 42
rpaB NP_898335.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-36 41
rpaB NP_898335.1 two-component response regulator BAC0308 Protein 9e-35 41
rpaB NP_898335.1 two-component response regulator CP001918.1.gene5135. Protein 8e-25 41
rpaB NP_898335.1 two-component response regulator NC_012469.1.7686381. Protein 6e-40 41
rpaB NP_898335.1 two-component response regulator AE016830.1.gene1681. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rpaB NP_898335.1 two-component response regulator VFG1390 Protein 5e-40 45
rpaB NP_898335.1 two-component response regulator VFG0596 Protein 2e-32 42
rpaB NP_898335.1 two-component response regulator VFG1389 Protein 6e-31 42