Name : spaQ (CV_2623) Accession : NP_902293.1 Strain : Chromobacterium violaceum ATCC 12472 Genome accession: NC_005085 Putative virulence/resistance : Virulence Product : surface presentation of antigens secretory protein Function : - COG functional category : U : Intracellular trafficking, secretion and vesicular transport COG ID : COG4794 EC number : - Position : 2831168 - 2831428 bp Length : 261 bp Strand : - Note : identified by sequence similarity; ORF located using Glimmer/GeneMark/Blastx/COG1987/TC:3.A.6.1.1 DNA sequence : ATGAACGATCTGGTTTTCGCCGGCAACAAGGCGCTGTACCTGGTGCTGATGATGTCGGCCTGGCCCATCATCGTGGCCAC CGTGATCGGCCTGCTGGTCGGTCTGTTCCAGACCGTGACCCAGCTGCAGGAACAGACGCTGCCTTTCGGCATCAAGCTGC TGGGCGTCAGCGTGTGCCTGTTCCTGCTGTCCGGCTGGTACGGCGAGACCTTGCTCGCCTTCGGCCGCGAAGTGATGCGG CTGGCGCTGGCCAAGGGATAG Protein sequence : MNDLVFAGNKALYLVLMMSAWPIIVATVIGLLVGLFQTVTQLQEQTLPFGIKLLGVSVCLFLLSGWYGETLLAFGREVMR LALAKG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 6e-30 | 84 |
spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 6e-30 | 84 |
spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 6e-30 | 84 |
spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 6e-30 | 84 |
spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 9e-29 | 80 |
epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 7e-26 | 75 |
ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 1e-25 | 74 |
ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 4e-16 | 56 |
hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 2e-11 | 47 |
hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 47 |
hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 47 |
hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 1e-09 | 47 |
hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 2e-09 | 45 |
lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 4e-09 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG0550 | Protein | 2e-30 | 84 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG1013 | Protein | 9e-23 | 71 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG2454 | Protein | 5e-17 | 60 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG1772 | Protein | 3e-20 | 54 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG0395 | Protein | 1e-10 | 47 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG0187 | Protein | 4e-04 | 46 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG0043 | Protein | 1e-07 | 43 |
spaQ | NP_902293.1 | surface presentation of antigens secretory protein | VFG2132 | Protein | 1e-08 | 42 |