
|
Name : fliQ (WS1489) Accession : NP_907642.1 Strain : Wolinella succinogenes DSM 1740 Genome accession: NC_005090 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 1426497 - 1426763 bp Length : 267 bp Strand : - Note : with proteins FliP and FliR forms the core of the central channel in the flagella export apparatus DNA sequence : ATGGAAGCGAAACTGATGGCTTTGGCGATTGAGACCTATAAAATCACGCTGATTCTCTCGCTTCCAATGCTGATGGCGGG CTTGGTGGTGGGACTTTTGATCAGTATTTTTCAAGCCACCACACAGATCAACGAACAGACCCTCACCTTTGTTCCTAAGA TTCTTGTGGTGATTGTGGTGGTGATCCTCACGATGCCATGGATGATGAATATGCTCATCGACTTCACCACGCGCCTTATT AAGATGATCCCCGATTTTCCCTTTTAG Protein sequence : MEAKLMALAIETYKITLILSLPMLMAGLVVGLLISIFQATTQINEQTLTFVPKILVVIVVVILTMPWMMNMLIDFTTRLI KMIPDFPF |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 5e-07 | 43 |
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 3e-07 | 43 |
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 3e-07 | 43 |
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 3e-07 | 43 |
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 5e-07 | 43 |
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 2e-07 | 42 |
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 8e-07 | 42 |
| escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 3e-08 | 41 |
| escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 5e-08 | 41 |
| escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 3e-08 | 41 |
| escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 5e-08 | 41 |
| escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 3e-08 | 41 |
| ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 5e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | NP_907642.1 | flagellar biosynthesis protein FliQ | VFG2339 | Protein | 2e-07 | 45 |
| fliQ | NP_907642.1 | flagellar biosynthesis protein FliQ | VFG0826 | Protein | 1e-08 | 41 |
| fliQ | NP_907642.1 | flagellar biosynthesis protein FliQ | VFG0716 | Protein | 1e-08 | 41 |