Gene Information

Name : glr2669 (glr2669)
Accession : NP_925615.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2831236 - 2831973 bp
Length : 738 bp
Strand : +
Note : -

DNA sequence :
GTGGTGGGCAACTTGGACAACCGCAAAGAAAAGATTCTTGTTGTCGACGACGAGGCCAGCATCCGCCGCATCCTGGAGAC
CCGTCTGTCGATGATTGGCTACGACGTGGTCACGGCTGCCGACGGTGAAGAGGCGCTCGAAGTCTTCAGCCGCGAGCACC
CGGACCTGGTCGTGCTCGATGTGATGATGCCGAAGCTGGACGGCTACGGCGTCTGCCAGGAACTGCGCAAGGACTCCGAC
GTCCCGATTATCATGCTGACCGCCCTGGGCGACGTGGCCGACCGGATCACGGGTCTGGAGCTGGGAGCGGACGACTACGT
CGTCAAGCCCTTCTCGCCTAAGGAACTGGAGGCGCGCATCCGCTCGGTCCTGCGCCGGGCCGACCGCGACACCGCGAGCG
GCATCCCGAGTTCGGGCGTCATTCACGTGGGCGATCTCAAGATCGACACCAACAAGCGCCAGGTCTACAAGCGCGGCGAG
CGCATTCGCCTGACCGGCATGGAATTTTCGCTGTTGGAGCTGGTGGTCAGCCGCTCCGGCGAGCCCTTTTCGCGCTCGGA
GATCCTTCAAGAAGTTTGGGGCTACACGCCCGAGCGCCACGTAGACACCCGCGTGGTCGATGTGCACATCTCGCGACTGC
GCTCCAAGCTCGAGGACGACCCGTCCAACCCGGAACTGATCCTCACTGCCCGCGGCACCGGCTATCTGTTCCAGCGCATC
ACCGAACCCAAAGAATAG

Protein sequence :
MVGNLDNRKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFSREHPDLVVLDVMMPKLDGYGVCQELRKDSD
VPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRADRDTASGIPSSGVIHVGDLKIDTNKRQVYKRGE
RIRLTGMEFSLLELVVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRSKLEDDPSNPELILTARGTGYLFQRI
TEPKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr2669 NP_925615.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-47 48
glr2669 NP_925615.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-47 48
glr2669 NP_925615.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-47 48
glr2669 NP_925615.1 two-component response regulator NC_012469.1.7685629. Protein 9e-45 47
glr2669 NP_925615.1 two-component response regulator HE999704.1.gene2815. Protein 6e-43 47
glr2669 NP_925615.1 two-component response regulator AE000516.2.gene3505. Protein 5e-43 46
glr2669 NP_925615.1 two-component response regulator BAC0125 Protein 4e-38 45
glr2669 NP_925615.1 two-component response regulator BAC0083 Protein 2e-36 43
glr2669 NP_925615.1 two-component response regulator BAC0197 Protein 3e-35 43
glr2669 NP_925615.1 two-component response regulator CP000034.1.gene3671. Protein 6e-40 43
glr2669 NP_925615.1 two-component response regulator BAC0308 Protein 4e-37 42
glr2669 NP_925615.1 two-component response regulator CP001918.1.gene5135. Protein 3e-26 42
glr2669 NP_925615.1 two-component response regulator BAC0638 Protein 3e-29 42
glr2669 NP_925615.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-36 41
glr2669 NP_925615.1 two-component response regulator CP004022.1.gene3215. Protein 6e-35 41
glr2669 NP_925615.1 two-component response regulator DQ212986.1.gene4.p01 Protein 9e-33 41
glr2669 NP_925615.1 two-component response regulator BAC0533 Protein 4e-30 41
glr2669 NP_925615.1 two-component response regulator CP000034.1.gene3834. Protein 4e-29 41
glr2669 NP_925615.1 two-component response regulator CP000647.1.gene4257. Protein 4e-30 41
glr2669 NP_925615.1 two-component response regulator NC_002695.1.915041.p Protein 4e-29 41
glr2669 NP_925615.1 two-component response regulator CP001138.1.gene4273. Protein 2e-29 41
glr2669 NP_925615.1 two-component response regulator NC_012469.1.7686381. Protein 2e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr2669 NP_925615.1 two-component response regulator VFG1390 Protein 3e-40 44
glr2669 NP_925615.1 two-component response regulator VFG1389 Protein 2e-33 44
glr2669 NP_925615.1 two-component response regulator VFG0596 Protein 1e-32 43