Gene Information

Name : glr3139 (glr3139)
Accession : NP_926085.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3341792 - 3342481 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGAACAACCCCATTTTGGTCGTTGAGGACGACGAGACCCTGGCGCAGGTGCTGCGCAAGACCCTCGAATCGGAAGGCTA
CACGGTGACGCTCGCCCGCGACGGCCGCGCTGCTTTGGAGTTGGGCCGCGAGCCGGGATTGCAGCTCATCATTCTCGACT
TGATGCTGCCGCGCATGAGCGGGCTGGAAGTTTGCCAACGCCTGCGCTCCGAGAACGTCGTCACACCGATCATCATGCTG
ACTGCCCGCGGCCTGGATACCGACAAGGTCTTCGGCCTGCGGCTCGGGGCGGACGATTACCTCAGCAAACCTTTTAACAT
CGATGAATTGCTGGCCCGCATTGAGGCGGTCCTGCGCCGCACCCACCAGAGCAAACCTTCCCAACACGTGAGCGTAGGGG
ACCTGGAGATCGATTTTCAGCGCCTGAGCGTCTGCAAAAACCGCCAAAAGCTCGATCTCTCCTCGCGGGAATTCCAGGTG
CTCGAGTGTCTGTTTCGCAGCGCCGGACAGACGGTGGACCGCGAAAAGATTTACCAGGAAGTCTGGGGCTACGACACCGC
CGTCACCAACCGCACCATCGACTTTCACATCGCCCGGCTGCGCTCCAAGCTCGAAGACAACCCCAAAGAACCGCGCTATA
TCCTCACGGTGCATGGCTCCGGGTACCGGTTCGTGGTGCCGGAGGTGTGA

Protein sequence :
MNNPILVVEDDETLAQVLRKTLESEGYTVTLARDGRAALELGREPGLQLIILDLMLPRMSGLEVCQRLRSENVVTPIIML
TARGLDTDKVFGLRLGADDYLSKPFNIDELLARIEAVLRRTHQSKPSQHVSVGDLEIDFQRLSVCKNRQKLDLSSREFQV
LECLFRSAGQTVDREKIYQEVWGYDTAVTNRTIDFHIARLRSKLEDNPKEPRYILTVHGSGYRFVVPEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-30 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr3139 NP_926085.1 two-component response regulator NC_012469.1.7685629. Protein 1e-38 45
glr3139 NP_926085.1 two-component response regulator CP004022.1.gene3215. Protein 1e-33 43
glr3139 NP_926085.1 two-component response regulator CP001138.1.gene4273. Protein 4e-28 43
glr3139 NP_926085.1 two-component response regulator NC_012469.1.7686381. Protein 2e-46 42
glr3139 NP_926085.1 two-component response regulator CP000034.1.gene3834. Protein 3e-28 42
glr3139 NP_926085.1 two-component response regulator CP000647.1.gene4257. Protein 2e-28 42
glr3139 NP_926085.1 two-component response regulator NC_002695.1.915041.p Protein 3e-28 42
glr3139 NP_926085.1 two-component response regulator BAC0533 Protein 2e-28 42
glr3139 NP_926085.1 two-component response regulator CP000034.1.gene3671. Protein 4e-35 42
glr3139 NP_926085.1 two-component response regulator AE000516.2.gene3505. Protein 2e-37 42
glr3139 NP_926085.1 two-component response regulator CP001918.1.gene5135. Protein 4e-24 42
glr3139 NP_926085.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator AE015929.1.gene1106. Protein 1e-31 41
glr3139 NP_926085.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-33 41
glr3139 NP_926085.1 two-component response regulator HE999704.1.gene1528. Protein 7e-32 41
glr3139 NP_926085.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-44 41
glr3139 NP_926085.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_007622.3794472.p0 Protein 8e-44 41
glr3139 NP_926085.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-43 41
glr3139 NP_926085.1 two-component response regulator BAC0125 Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr3139 NP_926085.1 two-component response regulator VFG0596 Protein 2e-30 41
glr3139 NP_926085.1 two-component response regulator VFG1563 Protein 2e-35 41
glr3139 NP_926085.1 two-component response regulator VFG1702 Protein 3e-35 41