Gene Information

Name : glr4128 (glr4128)
Accession : NP_927074.1
Strain : Gloeobacter violaceus PCC 7421
Genome accession: NC_005125
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4324532 - 4325236 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGGATGCAACGATGCGCCACCAGACGGTACTGGTGGTCGACGACGCAGAACTCATCCGCGAAACGGTGGGCATGGCCCT
TGGCGAGGAAGGCTACAGCGTCGTGCTGGCCGAGGACGGCCGCCAGGCGCTCGATTTGGTCCGCAACTCCGATAAAGTCG
ATTTGATCGTGCTCGACTTGATGTTGCCCCATCTCAACGGCCTTGATCTGTGCCGTTTGCTGCGCCGCGAGGGTAACGCC
GTGCCGATTTTGATGCTCACCGCCAAGGGCACCGAGACCGACCGGGTCGTGGGCCTCGAAGTGGGTGCCGACGACTATCT
ACCCAAGCCCTTTGGGATGCGCGAGCTGATTGCCCGCTGCCGGGCGGTGCTGCGCCGCCATACCCGCACCCAGACCCAGG
ACAACAGCGCTGTCCTGCGCTGCGGCGATCTGTGCATGAATACGCAAGAGTGCCGGGTGCGCGTGCGCGACGTCGAAGTC
GATCTTTCTCCTAAAGAATTTCGTCTGTTGGAACTATTCATGCGCAACCCGCGCCGGGTATGGTCGCGCGAGCAGCTCAT
CGAGCGGGTCTGGGGACCGGATTTCATGGGCGACAGCAAAACCGTCGATGTCCATATTCGCTGGCTGCGCGAGAAGCTCG
AGGCCGATCCCAGCCATCCCGAATATCTGGTGACGGTGCGGGGCTTCGGCTACCGCTTCGGCTAA

Protein sequence :
MDATMRHQTVLVVDDAELIRETVGMALGEEGYSVVLAEDGRQALDLVRNSDKVDLIVLDLMLPHLNGLDLCRLLRREGNA
VPILMLTAKGTETDRVVGLEVGADDYLPKPFGMRELIARCRAVLRRHTRTQTQDNSAVLRCGDLCMNTQECRVRVRDVEV
DLSPKEFRLLELFMRNPRRVWSREQLIERVWGPDFMGDSKTVDVHIRWLREKLEADPSHPEYLVTVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr4128 NP_927074.1 two-component response regulator AE016830.1.gene1681. Protein 2e-49 49
glr4128 NP_927074.1 two-component response regulator HE999704.1.gene2815. Protein 6e-46 47
glr4128 NP_927074.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_012469.1.7686381. Protein 1e-43 45
glr4128 NP_927074.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-41 45
glr4128 NP_927074.1 two-component response regulator AE000516.2.gene3505. Protein 8e-36 43
glr4128 NP_927074.1 two-component response regulator NC_012469.1.7685629. Protein 6e-43 43
glr4128 NP_927074.1 two-component response regulator CP001485.1.gene721.p Protein 3e-30 42
glr4128 NP_927074.1 two-component response regulator BAC0083 Protein 3e-29 42
glr4128 NP_927074.1 two-component response regulator CP000034.1.gene3671. Protein 2e-37 41
glr4128 NP_927074.1 two-component response regulator NC_008702.1.4607594. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
glr4128 NP_927074.1 two-component response regulator VFG1390 Protein 2e-42 46
glr4128 NP_927074.1 two-component response regulator VFG1389 Protein 4e-28 45
glr4128 NP_927074.1 two-component response regulator VFG1563 Protein 2e-36 42
glr4128 NP_927074.1 two-component response regulator VFG1702 Protein 2e-36 42