Gene Information

Name : VV0515 (VV0515)
Accession : NP_933308.1
Strain :
Genome accession: NC_005139
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 503386 - 503592 bp
Length : 207 bp
Strand : +
Note : identified by GeneMark and Glimmer2

DNA sequence :
GTGAAAATGAAATTTCTACGACTTAAAGACGTTATGTCACTAACAGGGCTAGGTCGCTCCACTATCTACAAGTTCATGGC
TGATGAAACCGATTTTCCGAAGAGTGTCCCACTCGGTGGACGTGCCGTGGCTTGGGTCGAAAGTGAAATAGAGGAATGGA
TGGAGCAACGTCTAGCACTGCGAGACAACCCAGAATCCTTTCAGTAA

Protein sequence :
MKMKFLRLKDVMSLTGLGRSTIYKFMADETDFPKSVPLGGRAVAWVESEIEEWMEQRLALRDNPESFQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 2e-24 93
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 9e-13 59
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 1e-12 59
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 1e-12 59
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 2e-07 50
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 4e-09 49
unnamed CAA21398.1 - Not tested HPI Protein 6e-09 49
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-13 49
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-13 49
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-13 49
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 4e-07 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VV0515 NP_933308.1 transcriptional regulator VFG1118 Protein 4e-13 59
VV0515 NP_933308.1 transcriptional regulator VFG1141 Protein 5e-14 49