Gene Information

Name : PHG144 (PHG144)
Accession : NP_942782.1
Strain :
Genome accession: NC_005241
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 139222 - 139572 bp
Length : 351 bp
Strand : -
Note : similar to Burkholderia fungorum gi:22982816; secreted or periplasmic

DNA sequence :
ATGTTTCGCCTCGACGCTGGGCTGCGGGTGTACCTGCATCGCGACGCTGTGGACTTCCGTAAGAACATCAACGGTCTGGC
ACTGCTGGTCGAGCAGGCGCTCGGGCTGGATCCGTTTGCATCTGCTGTATTTGTGTTCCGCAACCAGCGGGCCGATCGCA
TCAAGATTCTCGGCTGGGATCACAACGGCTTCTGGCTACTGTTGAAGCGATTGGAGGCGGACCGGTTTGCTTGGCCACGC
GAGGCGTCGGTGGCCACGCTGACGGTCGAACAGTTGCACTGGCTGCTCGAGGGAATTGACATCGAGGCGATGCGCCGGCA
CCCGCACCGAGAATACCATCGCGCTGCGTGA

Protein sequence :
MFRLDAGLRVYLHRDAVDFRKNINGLALLVEQALGLDPFASAVFVFRNQRADRIKILGWDHNGFWLLLKRLEADRFAWPR
EASVATLTVEQLHWLLEGIDIEAMRRHPHREYHRAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 5e-17 48
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-12 45
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-12 45
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-12 44
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-14 44
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-11 44
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-11 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-11 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-11 42
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-11 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-11 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-11 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-11 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-11 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-11 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-10 42
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-11 42
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-11 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-10 42
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-11 42
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-11 42
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-11 42
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PHG144 NP_942782.1 hypothetical protein VFG1665 Protein 1e-12 44
PHG144 NP_942782.1 hypothetical protein VFG1709 Protein 2e-11 42
PHG144 NP_942782.1 hypothetical protein VFG0792 Protein 2e-11 42
PHG144 NP_942782.1 hypothetical protein VFG1698 Protein 1e-11 42
PHG144 NP_942782.1 hypothetical protein VFG1052 Protein 2e-11 42
PHG144 NP_942782.1 hypothetical protein VFG1517 Protein 6e-10 41