Gene Information

Name : tnpB (PHG159)
Accession : NP_942797.1
Strain :
Genome accession: NC_005241
Putative virulence/resistance : Unknown
Product : transposition-related protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 157741 - 158088 bp
Length : 348 bp
Strand : +
Note : similar to Shigella flexneri 2a str. 301 gi:24111814

DNA sequence :
ATGATCGGGTTGCCGGCGGGAACACGCATCTGGATCGCTGCAGGCGTGACCGACATGCGCTGCGGATTCAACGGGCTCGC
CGCGAAGGTGGAGGCGACTCTGCAGGAGAGCCCGTTCTCCGGCCATGTCTTCGTCTTCCGCGGCAGGCGCGGCAACGTCA
TCAAGGTGTTGTGGTCAACGGGCGATGGGCTTTGCTTGCTCTCGAAGCGCCTGGAGCGCGGACGTTTCGTCTGGCCGCAG
GCCGACAGCGGCAAGATCCACCTGACGCAAGCGCAGTTGTCGATGCTGCTGGAGGGGATCAACTGGAAGCAGCCCGAGCG
CACCTGGCCGCCACTGTCGGTGTTGTAA

Protein sequence :
MIGLPAGTRIWIAAGVTDMRCGFNGLAAKVEATLQESPFSGHVFVFRGRRGNVIKVLWSTGDGLCLLSKRLERGRFVWPQ
ADSGKIHLTQAQLSMLLEGINWKQPERTWPPLSVL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-38 73
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-38 73
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-38 72
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-38 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-38 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-34 71
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-28 70
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-37 68
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-37 68
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-37 68
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-37 68
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-37 68
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-37 68
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-37 68
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-37 68
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 9e-37 68
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 9e-37 68
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-37 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-37 68
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-37 67
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-33 57
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-33 57
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-33 56
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-32 54
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-32 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tnpB NP_942797.1 transposition-related protein VFG1665 Protein 2e-38 72
tnpB NP_942797.1 transposition-related protein VFG1517 Protein 2e-28 70
tnpB NP_942797.1 transposition-related protein VFG0792 Protein 6e-38 68
tnpB NP_942797.1 transposition-related protein VFG1698 Protein 1e-37 68
tnpB NP_942797.1 transposition-related protein VFG1709 Protein 6e-38 68
tnpB NP_942797.1 transposition-related protein VFG1052 Protein 1e-37 67
tnpB NP_942797.1 transposition-related protein VFG1737 Protein 4e-34 56