Gene Information

Name : RPA1773 (RPA1773)
Accession : NP_947118.1
Strain : Rhodopseudomonas palustris CGA009
Genome accession: NC_005296
Putative virulence/resistance : Resistance
Product : DMT family permease
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1987669 - 1987998 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGAAGTGGCTCTATCTTCTGATTGCGATCGTCGCTGAGGTCGTCGGTACGTCGGCGCTGAAGGCGTCGCAGGGGTTTAC
GGTGCTGCTGCCGTCGGTGCTTGTTGTCGTCGGCTACGGCGCGGCGTTCTATTTCCTCTCGCTGACGCTGAGCAGCATCT
CGGTCGGCATCGCCTATGCGCTGTGGTCCGGGATCGGGATCGTGCTGATCTCGGCGGTCGGCTGGCTGTGGTTCGGCCAG
GCCTTGGACACGGCGGCGATAATTGGCATTGCGTTCATCATCGCCGGGGTTGGCATCATCAATTTTTTCTCGAACGTGTC
GGCGCATTAG

Protein sequence :
MKWLYLLIAIVAEVVGTSALKASQGFTVLLPSVLVVVGYGAAFYFLSLTLSSISVGIAYALWSGIGIVLISAVGWLWFGQ
ALDTAAIIGIAFIIAGVGIINFFSNVSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 65
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-20 65
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 65
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-20 65
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-20 65
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 65
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-20 65
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-20 65
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 65
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 65
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 65
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-20 65
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 65
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 65
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-20 65
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-20 65
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 65
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-20 65
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-20 65
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 65
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-09 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPA1773 NP_947118.1 DMT family permease BAC0002 Protein 2e-22 67
RPA1773 NP_947118.1 DMT family permease NC_010410.6003348.p0 Protein 2e-22 67
RPA1773 NP_947118.1 DMT family permease BAC0322 Protein 9e-22 65
RPA1773 NP_947118.1 DMT family permease BAC0323 Protein 5e-21 65
RPA1773 NP_947118.1 DMT family permease BAC0324 Protein 4e-21 62
RPA1773 NP_947118.1 DMT family permease BAC0150 Protein 2e-12 57
RPA1773 NP_947118.1 DMT family permease NC_002695.1.913273.p Protein 2e-12 57
RPA1773 NP_947118.1 DMT family permease BAC0377 Protein 1e-12 57
RPA1773 NP_947118.1 DMT family permease CP001138.1.gene1489. Protein 1e-15 52
RPA1773 NP_947118.1 DMT family permease CP004022.1.gene1549. Protein 8e-12 51
RPA1773 NP_947118.1 DMT family permease BAC0249 Protein 4e-10 50
RPA1773 NP_947118.1 DMT family permease AE000516.2.gene3301. Protein 4e-10 50
RPA1773 NP_947118.1 DMT family permease BAC0139 Protein 1e-13 47
RPA1773 NP_947118.1 DMT family permease BAC0329 Protein 1e-14 47
RPA1773 NP_947118.1 DMT family permease BAC0325 Protein 1e-12 43
RPA1773 NP_947118.1 DMT family permease BAC0326 Protein 8e-14 42
RPA1773 NP_947118.1 DMT family permease BAC0216 Protein 5e-05 42
RPA1773 NP_947118.1 DMT family permease BAC0327 Protein 7e-13 41
RPA1773 NP_947118.1 DMT family permease BAC0477 Protein 1e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPA1773 NP_947118.1 DMT family permease VFG1586 Protein 5e-10 42