Gene Information

Name : Bd2575 (Bd2575)
Accession : NP_969378.1
Strain : Bdellovibrio bacteriovorus HD100
Genome accession: NC_005363
Putative virulence/resistance : Virulence
Product : 2-component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2488688 - 2489296 bp
Length : 609 bp
Strand : +
Note : InterPro: Transcriptional regulatory protein C terminal

DNA sequence :
GTGGACCTCGCCGAAAGTGGATCAGCCGCTGAATCTTACATGGCCCAGGGCGATTATGACCTGGTGATACTGGATGTGAT
GCTGCCCGATCAAAGCGGCATCGACACCGCCCGCCACATTCGCCGCGACGGCTATGAAGGCCCGATTCTGATGCTGACGG
CCCTTTCCACCACCAAAGACAAAGTTCATGGACTGGATGCCGGCGCTGACGACTATCTGACCAAACCCTACTCTTTTGAT
GAGTTGCACGCCCGTGTGCGTGCGCTGCTTCGCCGTAAAGCCCCGTCCCAAGGCGGTGCGACCAGCAATATCCTGAAGTA
TGCGGACCTGGAACTGGATCTGATCCAGCGCAAAGCGCGCAGAAATTCCCAGGAGATCTCTTTGACCTCCAAAGAGTTCG
CCCTGCTTGAATACTTTATGCGAAATCCGGAGCGTCCTTTGGGGCGGGTCTCGATCGCTGAACATGTCTGGGACATTCAC
TTTGATTCGGAAAGCAACGTGATTGACGTCTATATCAATCTGTTGCGCAAAAAGATCGATGTCCCGTTCCCGAAACGTCT
GATTCATACGGTGGTGGGGACAGGATATGTTCTTAAAGAAAATCTATAA

Protein sequence :
MDLAESGSAAESYMAQGDYDLVILDVMLPDQSGIDTARHIRRDGYEGPILMLTALSTTKDKVHGLDAGADDYLTKPYSFD
ELHARVRALLRRKAPSQGGATSNILKYADLELDLIQRKARRNSQEISLTSKEFALLEYFMRNPERPLGRVSIAEHVWDIH
FDSESNVIDVYINLLRKKIDVPFPKRLIHTVVGTGYVLKENL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-32 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0111 Protein 3e-43 50
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0347 Protein 6e-37 50
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0308 Protein 4e-39 48
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0197 Protein 4e-39 48
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0638 Protein 4e-32 47
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0083 Protein 4e-39 46
Bd2575 NP_969378.1 2-component transcriptional regulator BAC0125 Protein 1e-39 44
Bd2575 NP_969378.1 2-component transcriptional regulator NC_003923.1003417.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_013450.8614146.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_002951.3238224.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_007793.3914065.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_002758.1121390.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_010079.5776364.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_002952.2859858.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator NC_007622.3794948.p0 Protein 2e-27 42
Bd2575 NP_969378.1 2-component transcriptional regulator AE015929.1.gene1106. Protein 1e-23 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bd2575 NP_969378.1 2-component transcriptional regulator VFG1390 Protein 1e-39 46
Bd2575 NP_969378.1 2-component transcriptional regulator VFG0596 Protein 6e-33 45
Bd2575 NP_969378.1 2-component transcriptional regulator VFG1386 Protein 1e-36 44