Gene Information

Name : PSPPH_1844 (PSPPH_1844)
Accession : YP_274076.1
Strain : Pseudomonas syringae 1448A
Genome accession: NC_005773
Putative virulence/resistance : Unknown
Product : ISPsy24, transposase orfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2141266 - 2141574 bp
Length : 309 bp
Strand : +
Note : identified by similarity to GB:AAT35126.1; match to protein family HMM PF01527

DNA sequence :
ATGACCAAACAACGCCGTACCTTTTCCGCTGAATTCAAACGCGAGGCCGCAGGCCTCGTGCTCGATCAAGGCTATAGCCA
CATTGAGGCCTCTCGCTCGCTGGGAGTTGTCGAGTCCGCACTGCGTCGCTGGGTTAACCAGCTTCAACAGGAGCGCAACG
GTGTCACTCCACAGAGCAAAGCCCTGACGCCCGAGCAGCAGAAAATTCAGGAGCTGGAAGCCCGGATTGCCCGTCTTGAG
CGGGAGAAATCCATTTTAAAAAAGGCTACCGCGCTCTTGATGTCGGAAGAGCACGAGCGCATGCGCTGA

Protein sequence :
MTKQRRTFSAEFKREAAGLVLDQGYSHIEASRSLGVVESALRRWVNQLQQERNGVTPQSKALTPEQQKIQELEARIARLE
REKSILKKATALLMSEEHERMR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-31 85
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 9e-16 58
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 58
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 58
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-16 58
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 58
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-16 58
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-16 58
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 58
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-16 58
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 9e-16 52
l7045 CAD33744.1 - Not tested PAI I 536 Protein 9e-17 52
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 9e-17 52
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-16 52
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-16 52
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-13 50
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-15 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-15 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-15 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-15 50
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-07 43
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 1e-06 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG1553 Protein 4e-16 58
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG1123 Protein 1e-16 58
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG1485 Protein 4e-17 52
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG0784 Protein 1e-15 50
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG1566 Protein 1e-07 43
PSPPH_1844 YP_274076.1 ISPsy24, transposase orfA VFG1521 Protein 6e-07 42