Gene Information

Name : TTC1356 (TTC1356)
Accession : YP_005325.1
Strain : Thermus thermophilus HB27
Genome accession: NC_005835
Putative virulence/resistance : Resistance
Product : heavy metal binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1290751 - 1290951 bp
Length : 201 bp
Strand : +
Note : -

DNA sequence :
ATGCTGAAGCTCAAGGTGGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTGACCAAGGCCCTGAAGAAGGTCCCCGG
CGTGGAGAAGGTGAAGGTCTCCCTAGAAAAGGGGGAGGCCCTGGTGGAGGGGACGGCCGACCCCAAGGCCCTCGTCCAGG
CGGTGGAGGAGGAAGGGTACAAGGCCGAGGTTCTGGCCTAA

Protein sequence :
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVKVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-08 45
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-07 44
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-07 44
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-07 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-07 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-07 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-07 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TTC1356 YP_005325.1 heavy metal binding protein BAC0085 Protein 2e-04 44
TTC1356 YP_005325.1 heavy metal binding protein BAC0231 Protein 7e-08 41