Name : TTC1356 (TTC1356) Accession : YP_005325.1 Strain : Thermus thermophilus HB27 Genome accession: NC_005835 Putative virulence/resistance : Resistance Product : heavy metal binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1290751 - 1290951 bp Length : 201 bp Strand : + Note : - DNA sequence : ATGCTGAAGCTCAAGGTGGAAGGCATGACCTGCAACCACTGCGTGATGGCGGTGACCAAGGCCCTGAAGAAGGTCCCCGG CGTGGAGAAGGTGAAGGTCTCCCTAGAAAAGGGGGAGGCCCTGGTGGAGGGGACGGCCGACCCCAAGGCCCTCGTCCAGG CGGTGGAGGAGGAAGGGTACAAGGCCGAGGTTCTGGCCTAA Protein sequence : MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVKVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 1e-08 | 45 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-07 | 44 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-07 | 44 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 44 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 44 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-07 | 44 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-07 | 44 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
TTC1356 | YP_005325.1 | heavy metal binding protein | BAC0085 | Protein | 2e-04 | 44 |
TTC1356 | YP_005325.1 | heavy metal binding protein | BAC0231 | Protein | 7e-08 | 41 |