Gene Information

Name : mrsR2 (BT9727_0923)
Accession : YP_035262.1
Strain : Bacillus thuringiensis 97-27
Genome accession: NC_005957
Putative virulence/resistance : Resistance
Product : two-component response regulator; MrsR2 protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1018912 - 1019634 bp
Length : 723 bp
Strand : +
Note : -

DNA sequence :
ATGATACATAATATTCCAGATGTTTATACAAAAAAAATTCTTATAGTAGATGATGAAAAAGAGATTTTAAATTTGTTGGA
AGCGGTTTTAAAGAAAGAAGGGTTTCGACATATTTATACGTGTACAACAGGAAAAGGTGGAATACACATGTGTAGGCAAG
TGCAACCAGATCTTATCCTATTAGACATTATGCTTCCAGATTTAGATGGATATAGTGTTTGTGAGCAAATTAGACAGTTT
ACATTCGTACCAATATTCTTCTTATCGGCAAAAAATGAAGATTTAGATAAAATACTTGGATTAAGTATAGGTGGTGATGA
TTACATTACAAAACCTTTTAGTCCAAAAGAAGTAGCGTATAAAATGAAAGCATTTTTTCGACGCAATCAATATAAAGAAA
AGAATCCGAATATGTATCAGTTTGGAGACATTACAATAGATGAGGCACAAGGGACAGTGCTAAGGGCTGGCACATTACTA
ACCTTAACAGCAAAAGAATTTAATATATTACTATTTTTAATAAAAAACCCAAATCAAATTTTTAGTAAGGCTCGATTATA
TGAAGCTGTCTGGGGCGAAACATACTTGGGGAATGATAATATTATGATGGTACATATGAGACATTTAAGAGAAAAAATAG
AGGATAATCCCTCTAAACCTAATTATCTTATAACAGTAAGGGGACTTGGATATAAACTTAATACAAAAGGTGATGCAAAA
TGA

Protein sequence :
MIHNIPDVYTKKILIVDDEKEILNLLEAVLKKEGFRHIYTCTTGKGGIHMCRQVQPDLILLDIMLPDLDGYSVCEQIRQF
TFVPIFFLSAKNEDLDKILGLSIGGDDYITKPFSPKEVAYKMKAFFRRNQYKEKNPNMYQFGDITIDEAQGTVLRAGTLL
TLTAKEFNILLFLIKNPNQIFSKARLYEAVWGETYLGNDNIMMVHMRHLREKIEDNPSKPNYLITVRGLGYKLNTKGDAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 6e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein AF155139.2.orf0.gene Protein 3e-35 43
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein HE999704.1.gene2815. Protein 3e-35 43
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein FJ349556.1.orf0.gene Protein 4e-35 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_012469.1.7686381. Protein 9e-33 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_002952.2859905.p0 Protein 2e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein AE016830.1.gene1681. Protein 4e-35 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_009641.5332272.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_013450.8614421.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_007793.3914279.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_003923.1003749.p0 Protein 4e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_002745.1124361.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_009782.5559369.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_002951.3237708.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_007622.3794472.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_002758.1121668.p0 Protein 3e-36 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein NC_012469.1.7685629. Protein 3e-32 42
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein AF162694.1.orf4.gene Protein 6e-31 41
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein AM180355.1.gene1830. Protein 1e-34 41
mrsR2 YP_035262.1 two-component response regulator; MrsR2 protein AF130997.1.orf0.gene Protein 6e-31 41