Gene Information

Name : BT9727_0378 (BT9727_0378)
Accession : YP_034728.1
Strain : Bacillus thuringiensis 97-27
Genome accession: NC_005957
Putative virulence/resistance : Resistance
Product : TerD family tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 444342 - 444920 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGTTATTCAATTGCAAAAAGGACAGAAGATTGATTTAGGTAAGACAAGCCCTGGTTTAACAAAAGCAGTAATTGGTCT
TGGATGGGATATTAAATCTTATGACGGTGGATCAGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGCGAACGGAA
AATGTACGAAGGAAACTGATTTTATCTTCTATAACAATTTACAGTCTCCTTGTGGATCTGTTCTACATACAGGAGATAAC
CGCACAGGTGAAGGTGAAGGCGACGATGAGCAACTTGTTGTAGATTTGAAGAAAGTTCCAGCAGATGTGCATAGAATTGC
TATTACAGTTACGATTTATGATGCGGAAGGCCGTAGTCAAAACTTTGGACAAGTAGGAAATGCGTTCGTTCGTTTAGCGA
ATGAAGAAACGAATGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATTGAAACAGCAGTTGTCTTTTGTGAA
TTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGCGGATTCCAAGGTGGTTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAA

Protein sequence :
MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-44 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 57
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-48 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-42 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-42 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-42 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-40 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BT9727_0378 YP_034728.1 TerD family tellurium resistance protein BAC0389 Protein 2e-44 59
BT9727_0378 YP_034728.1 TerD family tellurium resistance protein BAC0390 Protein 3e-43 53