Gene Information

Name : STH1041 (STH1041)
Accession : YP_074870.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1160779 - 1161483 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
GTGGCGATGGCGACTGGCAAGAAGCGCATCCTGGTGGTCGACGACGACCCGAAGATCCTGAAGGCCCTGGACCAGGCCCT
CCAGCAGGAGGGGTACGAGGTCTACCGGGCGGAGGACGGCCTGCAGGCCCTCGAGATGGCGCGCAAGGTGAAGCCGGACC
TGATGATCCTTGACATCATGCTGCCCAAGATGGACGGGTTCGAGGTCCTGGCCCAGCTGCAGTCGACGGGCGGCGTCCCC
ACGCTCATCCTCTCCGCCCGCGGGGAGGAGATGGACAAGGTGGTCGGGTTCAACGTCGGGGCGGACGACTACCTGGTGAA
GCCGTTCCGGCTCTCGGAGCTCCTCCTGCGGGTCCGGGCGATCCTGCGCCGCACGGCCGGCGCCGGCGCGCCCGTGGACG
AGGACCGGCCGCTGAAGTTCAGGGACATCGAGATCAACCGCTCCTCCCGCACCGTCATCGTGCGGGGTCAGCCGGTGGAC
CTGACGCCCAAGGAGTTCGACCTGCTCTGGCTCCTGGCCAGCCACCCCGGGCACGTCTTCAGCCGGGAGGCCCTGCTGCA
GCGGGTGTGGCACTCCGAGTACTCCGGCGACGAGGCGGCGCTCACCGTCTGCGTGCGCCGGCTGAGGGAGAAGATCGAGC
GCGACCCCGGCCACCCGGAGCTGATCAAGACCATTTGGGGGATTGGGTATAAGTTTGATGGATGA

Protein sequence :
MAMATGKKRILVVDDDPKILKALDQALQQEGYEVYRAEDGLQALEMARKVKPDLMILDIMLPKMDGFEVLAQLQSTGGVP
TLILSARGEEMDKVVGFNVGADDYLVKPFRLSELLLRVRAILRRTAGAGAPVDEDRPLKFRDIEINRSSRTVIVRGQPVD
LTPKEFDLLWLLASHPGHVFSREALLQRVWHSEYSGDEAALTVCVRRLREKIERDPGHPELIKTIWGIGYKFDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH1041 YP_074870.1 two-component response regulator NC_012469.1.7685629. Protein 6e-41 46
STH1041 YP_074870.1 two-component response regulator HE999704.1.gene2815. Protein 3e-46 45
STH1041 YP_074870.1 two-component response regulator FJ349556.1.orf0.gene Protein 6e-47 45
STH1041 YP_074870.1 two-component response regulator AE000516.2.gene3505. Protein 1e-38 43
STH1041 YP_074870.1 two-component response regulator AF155139.2.orf0.gene Protein 9e-45 43
STH1041 YP_074870.1 two-component response regulator AE016830.1.gene1681. Protein 7e-45 42
STH1041 YP_074870.1 two-component response regulator BAC0638 Protein 6e-32 42
STH1041 YP_074870.1 two-component response regulator NC_012469.1.7686381. Protein 7e-38 42
STH1041 YP_074870.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-40 42
STH1041 YP_074870.1 two-component response regulator BAC0308 Protein 3e-35 41
STH1041 YP_074870.1 two-component response regulator BAC0347 Protein 3e-34 41
STH1041 YP_074870.1 two-component response regulator CP001138.1.gene4273. Protein 4e-27 41
STH1041 YP_074870.1 two-component response regulator CP001918.1.gene5135. Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH1041 YP_074870.1 two-component response regulator VFG1390 Protein 3e-39 44
STH1041 YP_074870.1 two-component response regulator VFG1702 Protein 1e-36 43
STH1041 YP_074870.1 two-component response regulator VFG1563 Protein 8e-37 43
STH1041 YP_074870.1 two-component response regulator VFG1386 Protein 4e-42 43
STH1041 YP_074870.1 two-component response regulator VFG1389 Protein 2e-32 41