Gene Information

Name : STH731 (STH731)
Accession : YP_074560.1
Strain : Symbiobacterium thermophilum IAM 14863
Genome accession: NC_006177
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 815065 - 815760 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
GTGTCCGTAGCTCGCCGGATTCTGGTGGCCGACGACGACCCGAAGACCCTGAAGGTCCTGGAGCATGCGCTGACCGCCGA
GGGGTTCGCGGTGATCAAGGCCAGCGACGGCCAGGAGGCCCTGGACCTCGCCCTGTCGCAACGGCCGGACCTGGTCATCC
TCGACGTCATGATGCCGAAAGTGGACGGCTTCGCGGTCTGTGGCCGCATTCGCGCCGCCTCGGCGGTGCCGATCCTCCTG
CTCACCGCCAGGGGCGACAGCGTCGACAAGGTCGTCGGCTTCCGGCTGGGGGCCGACGACTACGTGACCAAACCCTTCGA
CCTGAACGAGCTGGTGCTGCGGGTGCACGCCATCCTGCGCCGGATGCCCACCCTGCCCGAGAGCCGCACCCTGCGCTTCG
GCCACCTGGAGATCAACAAGAGCACGCGCACGGTGCACGTGGGCGACCGGAACCCGGAGCTCACCCCCAGGGAGTTCGAC
CTGCTCTGGCTGATGGCCAGCCACCCGGGCCACCCCTTCACCCGGGAGTCCCTCCTGGCCCGCGTGTGGCACGGCGACGC
ACCCACCGACCAGTCCACCGTCACCGTCTGCATCCGCCGGCTCCGGGAGAAGATCGAGGACAACCCCGCTCAGCCCCGGT
GGATCAAGACGGTCTGGGGAATCGGCTACAAGTTCGATCCGGCGGGCGCCGAATGA

Protein sequence :
MSVARRILVADDDPKTLKVLEHALTAEGFAVIKASDGQEALDLALSQRPDLVILDVMMPKVDGFAVCGRIRAASAVPILL
LTARGDSVDKVVGFRLGADDYVTKPFDLNELVLRVHAILRRMPTLPESRTLRFGHLEINKSTRTVHVGDRNPELTPREFD
LLWLMASHPGHPFTRESLLARVWHGDAPTDQSTVTVCIRRLREKIEDNPAQPRWIKTVWGIGYKFDPAGAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH731 YP_074560.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-46 47
STH731 YP_074560.1 two-component response regulator AE000516.2.gene3505. Protein 1e-34 45
STH731 YP_074560.1 two-component response regulator FJ349556.1.orf0.gene Protein 8e-45 44
STH731 YP_074560.1 two-component response regulator NC_012469.1.7685629. Protein 3e-42 44
STH731 YP_074560.1 two-component response regulator BAC0197 Protein 3e-37 44
STH731 YP_074560.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-42 43
STH731 YP_074560.1 two-component response regulator BAC0125 Protein 2e-37 43
STH731 YP_074560.1 two-component response regulator NC_002952.2859905.p0 Protein 5e-42 43
STH731 YP_074560.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-42 42
STH731 YP_074560.1 two-component response regulator HE999704.1.gene2815. Protein 7e-45 42
STH731 YP_074560.1 two-component response regulator NC_012469.1.7686381. Protein 1e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STH731 YP_074560.1 two-component response regulator VFG1390 Protein 3e-39 44
STH731 YP_074560.1 two-component response regulator VFG1389 Protein 2e-30 43
STH731 YP_074560.1 two-component response regulator VFG1386 Protein 3e-35 41