Gene Information

Name : phoP (BL00396)
Accession : YP_080203.2
Strain : Bacillus licheniformis DSM 13
Genome accession: NC_006270
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2945101 - 2945823 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAAAAAGATATTAGTTGTAGATGATGAGGAATCGATTGTTACCCTTCTAAAATATAACCTTGAACGGTCGGGCTA
TCATGTGGTGACCGCCATGGACGGAGAGGCCGGCTTATTAAAGGCGATTGAAGAGAAGCCGGATCTGATCGTGCTCGATC
TGATGCTTCCTAAAATGGACGGCATTGAAGTATGCAAGGAACTCAGACAGAAGAAGCTGATGTATCCGATTTTGATGCTG
ACCGCAAAGGATGATGAATTTGATAAAGTGCTCGGTCTCGAGCTGGGTGCCGATGACTATATGACAAAGCCGTTCAGCCC
GAGAGAGGTGACGGCAAGGGTCAAAGCGATTTTAAGAAGAACACAGACGCTGTCCGTTCAGCCGGAGGAGACGGAAGAAC
CGGATGCAGGCGAGCTGATCATAGGCGAACTGAAAATACTGCCTGAACATTATGAGGTTTATTTTCAAAACGAACGCCTC
GAGCTGACGCCGAAGGAATTCGAACTTCTCTTATATTTGGGAAGGCATAAAGGGAGGGTGCTGACGAGAGACCTTCTCCT
CAACGCTGTCTGGAACTACGACTTCGCGGGCGATACGCGCATCGTCGATGTCCACATCAGCCACCTTCGCGATAAGATCG
AAAAAAATACAAAAAAACCGGAATACATTAAAACAATCAGAGGTCTTGGCTACAAAATGGAGGAGCCGAAACTGAATGAT
TAA

Protein sequence :
MSKKILVVDDEESIVTLLKYNLERSGYHVVTAMDGEAGLLKAIEEKPDLIVLDLMLPKMDGIEVCKELRQKKLMYPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVTARVKAILRRTQTLSVQPEETEEPDAGELIIGELKILPEHYEVYFQNERL
ELTPKEFELLLYLGRHKGRVLTRDLLLNAVWNYDFAGDTRIVDVHISHLRDKIEKNTKKPEYIKTIRGLGYKMEEPKLND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-37 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_080203.2 two-component response regulator HE999704.1.gene2815. Protein 9e-77 69
phoP YP_080203.2 two-component response regulator NC_002952.2859905.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_009782.5559369.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_002951.3237708.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_002758.1121668.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_007622.3794472.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_009641.5332272.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_013450.8614421.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_007793.3914279.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_003923.1003749.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator NC_002745.1124361.p0 Protein 2e-75 68
phoP YP_080203.2 two-component response regulator AE016830.1.gene1681. Protein 4e-65 57
phoP YP_080203.2 two-component response regulator NC_012469.1.7686381. Protein 2e-60 55
phoP YP_080203.2 two-component response regulator NC_012469.1.7685629. Protein 3e-57 54
phoP YP_080203.2 two-component response regulator CP004022.1.gene3215. Protein 5e-40 45
phoP YP_080203.2 two-component response regulator AF162694.1.orf4.gene Protein 4e-38 43
phoP YP_080203.2 two-component response regulator AF155139.2.orf0.gene Protein 2e-39 43
phoP YP_080203.2 two-component response regulator CP001485.1.gene721.p Protein 7e-36 43
phoP YP_080203.2 two-component response regulator NC_014475.1.orf0.gen Protein 6e-41 42
phoP YP_080203.2 two-component response regulator NC_005054.2598277.p0 Protein 6e-41 42
phoP YP_080203.2 two-component response regulator AF130997.1.orf0.gene Protein 1e-36 42
phoP YP_080203.2 two-component response regulator AE000516.2.gene3505. Protein 4e-41 42
phoP YP_080203.2 two-component response regulator FJ349556.1.orf0.gene Protein 3e-41 42
phoP YP_080203.2 two-component response regulator CP000647.1.gene4257. Protein 1e-35 42
phoP YP_080203.2 two-component response regulator BAC0533 Protein 1e-35 42
phoP YP_080203.2 two-component response regulator AF310956.2.orf0.gene Protein 1e-37 41
phoP YP_080203.2 two-component response regulator AE016830.1.gene2255. Protein 3e-36 41
phoP YP_080203.2 two-component response regulator U35369.1.gene1.p01 Protein 3e-36 41
phoP YP_080203.2 two-component response regulator AM180355.1.gene1830. Protein 2e-38 41
phoP YP_080203.2 two-component response regulator HE999704.1.gene1528. Protein 3e-32 41
phoP YP_080203.2 two-component response regulator EU250284.1.orf4.gene Protein 2e-41 41
phoP YP_080203.2 two-component response regulator BAC0197 Protein 2e-29 41
phoP YP_080203.2 two-component response regulator DQ212986.1.gene4.p01 Protein 2e-40 41
phoP YP_080203.2 two-component response regulator CP000034.1.gene3834. Protein 7e-35 41
phoP YP_080203.2 two-component response regulator CP001138.1.gene4273. Protein 4e-35 41
phoP YP_080203.2 two-component response regulator NC_002695.1.915041.p Protein 7e-35 41
phoP YP_080203.2 two-component response regulator CP001918.1.gene5135. Protein 1e-30 41
phoP YP_080203.2 two-component response regulator CP004022.1.gene1676. Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_080203.2 two-component response regulator VFG1386 Protein 6e-39 42
phoP YP_080203.2 two-component response regulator VFG1389 Protein 2e-32 42
phoP YP_080203.2 two-component response regulator VFG1390 Protein 1e-35 41