Gene Information

Name : walR (BLi04335)
Accession : YP_006715598.1
Strain : Bacillus licheniformis DSM 13
Genome accession: NC_006322
Putative virulence/resistance : Virulence
Product : two-component response regulator WalR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4186065 - 4186772 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGGAAAAAAAGATACTAGTTGTAGATGATGAAAAGCCGATTGCTGATATTTTAGAGTTTAATCTGAAAAAAGAGGGCTA
TGAAGTCCATTGCGCATACGACGGCAATGAAGCGCTTCAGATGGTTGAGGATCTCAACCCTGATATGATTCTGCTCGACA
TCATGCTTCCGAATAAAGACGGTGTGGAAGTGTGCCGTGAAGTCCGCAAAAAATATGATATGCCCATCATTATGCTGACA
GCAAAGGATTCGGAAATCGATAAAGTCATCGGCCTTGAACTGGGCGCTGACGATTATGTGACAAAACCGTTCAGCACCCG
CGAACTGCTGGCGCGTGTCAAAGCGAACCTGAGAAGACAGAACACAGCGGCTCCTGCCGAAGAAGAATCGTCTTCAAACG
AAATTCAAATCGGATCGCTCGTCATTTTTCCGGATGCCTATGTCGTTTCAAAACGCGACGAGACAATCGAGCTGACACAT
CGGGAATTCGAACTGCTGCATTACCTTGCAAAACATATCGGGCAAGTCATGACGCGTGAACATCTTCTGCAAACCGTGTG
GGGATACGACTACTTTGGGGATGTCCGGACAGTTGACGTTACGGTTAGACGCCTTCGCGAAAAAATCGAGGATAATCCGA
GTCACCCAAGCTGGATCGTTACAAGGCGCGGTGTCGGCTACTATTTGAGAAATCCGGAACAGGACTAA

Protein sequence :
MEKKILVVDDEKPIADILEFNLKKEGYEVHCAYDGNEALQMVEDLNPDMILLDIMLPNKDGVEVCREVRKKYDMPIIMLT
AKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANLRRQNTAAPAEEESSSNEIQIGSLVIFPDAYVVSKRDETIELTH
REFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPSWIVTRRGVGYYLRNPEQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_006715598.1 two-component response regulator WalR NC_012469.1.7685629. Protein 3e-63 68
walR YP_006715598.1 two-component response regulator WalR NC_009782.5559369.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_002951.3237708.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_002952.2859905.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_002758.1121668.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_009641.5332272.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_013450.8614421.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_007793.3914279.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_003923.1003749.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_007622.3794472.p0 Protein 2e-52 55
walR YP_006715598.1 two-component response regulator WalR NC_002745.1124361.p0 Protein 4e-52 55
walR YP_006715598.1 two-component response regulator WalR HE999704.1.gene2815. Protein 1e-46 53
walR YP_006715598.1 two-component response regulator WalR NC_012469.1.7686381. Protein 2e-42 49
walR YP_006715598.1 two-component response regulator WalR AE016830.1.gene1681. Protein 4e-43 47
walR YP_006715598.1 two-component response regulator WalR AM180355.1.gene1830. Protein 2e-38 46
walR YP_006715598.1 two-component response regulator WalR FJ349556.1.orf0.gene Protein 5e-38 46
walR YP_006715598.1 two-component response regulator WalR HE999704.1.gene1528. Protein 1e-30 45
walR YP_006715598.1 two-component response regulator WalR AE000516.2.gene3505. Protein 7e-36 45
walR YP_006715598.1 two-component response regulator WalR DQ212986.1.gene4.p01 Protein 1e-36 44
walR YP_006715598.1 two-component response regulator WalR AF155139.2.orf0.gene Protein 6e-34 44
walR YP_006715598.1 two-component response regulator WalR CP001918.1.gene5135. Protein 1e-26 43
walR YP_006715598.1 two-component response regulator WalR CP004022.1.gene3215. Protein 2e-35 43
walR YP_006715598.1 two-component response regulator WalR NC_007622.3794948.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_003923.1003417.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_013450.8614146.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_002951.3238224.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_007793.3914065.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_002758.1121390.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_010079.5776364.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR NC_002952.2859858.p0 Protein 3e-34 43
walR YP_006715598.1 two-component response regulator WalR AF130997.1.orf0.gene Protein 3e-34 42
walR YP_006715598.1 two-component response regulator WalR NC_014475.1.orf0.gen Protein 1e-35 42
walR YP_006715598.1 two-component response regulator WalR NC_005054.2598277.p0 Protein 1e-35 42
walR YP_006715598.1 two-component response regulator WalR AE015929.1.gene1106. Protein 3e-29 42
walR YP_006715598.1 two-component response regulator WalR BAC0533 Protein 4e-30 41
walR YP_006715598.1 two-component response regulator WalR NC_002695.1.915041.p Protein 2e-30 41
walR YP_006715598.1 two-component response regulator WalR AF162694.1.orf4.gene Protein 3e-32 41
walR YP_006715598.1 two-component response regulator WalR CP000647.1.gene4257. Protein 4e-30 41
walR YP_006715598.1 two-component response regulator WalR CP000034.1.gene3834. Protein 2e-30 41
walR YP_006715598.1 two-component response regulator WalR EU250284.1.orf4.gene Protein 2e-33 41
walR YP_006715598.1 two-component response regulator WalR CP004022.1.gene1676. Protein 4e-27 41
walR YP_006715598.1 two-component response regulator WalR NC_002695.1.916589.p Protein 6e-28 41
walR YP_006715598.1 two-component response regulator WalR BAC0039 Protein 5e-28 41
walR YP_006715598.1 two-component response regulator WalR CP000034.1.gene2186. Protein 5e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_006715598.1 two-component response regulator WalR VFG1389 Protein 3e-28 43
walR YP_006715598.1 two-component response regulator WalR VFG1390 Protein 2e-33 42
walR YP_006715598.1 two-component response regulator WalR VFG1563 Protein 1e-31 42
walR YP_006715598.1 two-component response regulator WalR VFG1702 Protein 1e-31 41