Gene Information

Name : BF2185 (BF2185)
Accession : YP_099466.1
Strain : Bacteroides fragilis YCH46
Genome accession: NC_006347
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2551946 - 2552620 bp
Length : 675 bp
Strand : +
Note : similar to gp:AE016928_195 [Bacteroides thetaiotaomicron VPI-5482], percent identity 79 in 224 aa, BLASTP E(): e-101

DNA sequence :
ATGGCTAAGATATTATTGGTAGAAGATGAAGTGAATATAGCTTCGTTTATAGAACGGGGTTTGAAGGAGTTTGGACATTC
TGTGTCGGTGGCTAATGACGGTGATGCCGGATGGGAACTCATCCGGCAAGAAGCATTCGACCTGTTGATCCTGGATATTA
TCATGCCTAAGATGAACGGTCTGGAGCTATGCCGGCTTTATCGGCAGCAATACGGTTATCTCACCCCGGTTATAATGTTG
ACTGCATTGGGCACCACGGAGGATATCGTGAAAGGGCTCGATTCGGGGGCGGATGACTATTTGGTGAAACCATTCAGCTT
TCAGGAACTGGAGGCGCGCATCAAGGCCATCCTGCGCAGAGGGCGGGAAGACTCTGTCCAGCAACTGGTATGTGATGATC
TGGTGCTTAACTGCAACACCCGCCGTGCCAGACGTAAGGAGGTGGAGATTGAACTCACTGTTAAGGAGTACCGCTTGCTG
GAGTATTTCATGACCCATCAAGGCATGGTGCTTTCGCGCCTGACATTATTGAAAGATGTATGGGATAAGAATTTCGATAC
GAATACCAATGTGGTAGATGTTTATGTGAACTATCTTCGTGGTAAAATAGATAAGGAGCATGACAAGAAATTGATTCATA
CGGTGGTAGGTTCGGGATATATCATGTATGCTTAA

Protein sequence :
MAKILLVEDEVNIASFIERGLKEFGHSVSVANDGDAGWELIRQEAFDLLILDIIMPKMNGLELCRLYRQQYGYLTPVIML
TALGTTEDIVKGLDSGADDYLVKPFSFQELEARIKAILRRGREDSVQQLVCDDLVLNCNTRRARRKEVEIELTVKEYRLL
EYFMTHQGMVLSRLTLLKDVWDKNFDTNTNVVDVYVNYLRGKIDKEHDKKLIHTVVGSGYIMYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF2185 YP_099466.1 two-component system response regulator HE999704.1.gene1528. Protein 4e-27 47
BF2185 YP_099466.1 two-component system response regulator BAC0111 Protein 2e-39 47
BF2185 YP_099466.1 two-component system response regulator BAC0083 Protein 3e-31 46
BF2185 YP_099466.1 two-component system response regulator BAC0347 Protein 2e-35 45
BF2185 YP_099466.1 two-component system response regulator BAC0125 Protein 1e-33 45
BF2185 YP_099466.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-27 44
BF2185 YP_099466.1 two-component system response regulator BAC0197 Protein 8e-31 44
BF2185 YP_099466.1 two-component system response regulator AE015929.1.gene1106. Protein 3e-24 43
BF2185 YP_099466.1 two-component system response regulator BAC0638 Protein 7e-25 43
BF2185 YP_099466.1 two-component system response regulator BAC0308 Protein 1e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF2185 YP_099466.1 two-component system response regulator VFG0596 Protein 2e-27 43