Name : qacE (BPSL1861) Accession : YP_108460.1 Strain : Genome accession: NC_006350 Putative virulence/resistance : Virulence Product : quaternary ammonium compound-resistance protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2215194 - 2215532 bp Length : 339 bp Strand : - Note : Similar to Escherichia coli, Salmonella typhimurium, and Pseudomonas aeruginosa ethidium bromide resistance protein Ebr or E1 SWALL:EBR_ECOLI (SWALL:P14502) (115 aa) fasta scores: E(): 1.7e-16, 53% id in 100 aa, and to the plasmid borne Escherichia coli, DNA sequence : ATGCAACTTCCAGGTTACGCATGGCTCGCGATCGCGATCGTCGCCGAGGTGGTCGGCACGTCGGCGCTGCGCGCAGCCGA AGGTTTCACGCGGCTCTGGCCGACGCTCGTCGTCGCCCTCGGCTACGGCACCGCGTTCTACTGCCTGTCGCTCACGCTCA AGAGCATGCCCGTCGGCATCGTGTACGCGATCTGGTCGGGCGCGGGCATCGTGCTCATCACGCTCGTCGCGCTCGTGCTC TATCGGCAGGTGCCGGACTGGCCCGCGGTCGTCGGGCTCGCGCTCATCGTCGCGGGCGTCGTGGTGCTCAATCTCTTTTC GAAAATGCAGGCGCATTGA Protein sequence : MQLPGYAWLAIAIVAEVVGTSALRAAEGFTRLWPTLVVALGYGTAFYCLSLTLKSMPVGIVYAIWSGAGIVLITLVALVL YRQVPDWPAVVGLALIVAGVVVLNLFSKMQAH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 8e-17 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0377 | Protein | 8e-22 | 60 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0322 | Protein | 2e-15 | 58 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0002 | Protein | 4e-16 | 55 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | NC_010410.6003348.p0 | Protein | 4e-16 | 55 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | CP004022.1.gene1549. | Protein | 2e-15 | 50 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | CP001138.1.gene1489. | Protein | 7e-14 | 50 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | AE000516.2.gene3301. | Protein | 6e-10 | 50 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0249 | Protein | 6e-10 | 50 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | NC_002695.1.913273.p | Protein | 5e-12 | 49 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0150 | Protein | 5e-12 | 47 |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | BAC0327 | Protein | 2e-16 | 47 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
qacE | YP_108460.1 | quaternary ammonium compound-resistance protein | VFG1586 | Protein | 3e-17 | 41 |