Gene Information

Name : BPSS2078 (BPSS2078)
Accession : YP_112079.1
Strain :
Genome accession: NC_006351
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2812870 - 2813217 bp
Length : 348 bp
Strand : -
Note : Similar to Escherichia coli hypothetical protein Hp4 SWALL:O88118 (EMBL:AF081284) (115 aa) fasta scores: E(): 3.5e-32, 69.56% id in 115 aa, and to Shigella flexneri 2a hypothetical protein SWALL:Q93F14 (EMBL:AF326777) (115 aa) fasta scores: E(): 1.5e-31,

DNA sequence :
ATGATCGGACTACCCAGCCACACGAAGATCTGGCTGGCCGCCGGCGTGACCGACATGCGCTCGGGCTTCAATCGCTTGGC
TGCGAAGGTCCAGACCGTGCTGAAGCGAGATCCGTTCAGCGGCCACGTGTTCGTGTTCCGCGGCAAGCGTGGCGATCTGG
TCAAAGTGTTGTGGTGGAGCGGCGACGGCATGTGTCTGCTGATGAAACGCCTGGAGCGCGGTCGGTTCGTGTGGCCACGT
GCCGATGGTGGCGTGGTGTGCCTGAGCCAGGCGCAACTGTCGATGCTGCTCGAAGGTATCGACTGGCGGCAACCAGTCCG
CACGACGGAGCCGACATCGGCGTTGTAA

Protein sequence :
MIGLPSHTKIWLAAGVTDMRSGFNRLAAKVQTVLKRDPFSGHVFVFRGKRGDLVKVLWWSGDGMCLLMKRLERGRFVWPR
ADGGVVCLSQAQLSMLLEGIDWRQPVRTTEPTSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-38 76
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-34 74
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-34 74
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-34 74
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-34 74
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 8e-34 74
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-34 74
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 8e-34 74
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 8e-34 74
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-33 73
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-33 73
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-33 73
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-33 73
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-33 72
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-25 71
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-34 67
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-34 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-34 67
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-31 64
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-31 64
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-29 60
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-29 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-30 60
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-30 60
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-30 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BPSS2078 YP_112079.1 hypothetical protein VFG1709 Protein 2e-34 74
BPSS2078 YP_112079.1 hypothetical protein VFG0792 Protein 2e-34 74
BPSS2078 YP_112079.1 hypothetical protein VFG1698 Protein 5e-34 73
BPSS2078 YP_112079.1 hypothetical protein VFG1052 Protein 5e-34 72
BPSS2078 YP_112079.1 hypothetical protein VFG1517 Protein 8e-26 71
BPSS2078 YP_112079.1 hypothetical protein VFG1665 Protein 1e-34 67
BPSS2078 YP_112079.1 hypothetical protein VFG1737 Protein 1e-30 58