Gene Information

Name : nfa49640 (nfa49640)
Accession : YP_121180.1
Strain : Nocardia farcinica IFM 10152
Genome accession: NC_006361
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5180449 - 5181135 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGCGCATTCTGGTAGTCGACGACGATCGCGCCGTCCGGGAATCGCTGCGCCGGTCGTTGACCTTCAACGGCTACACCGT
GGACCTCGCCGTGGACGGGGTCGACGCACTGGAGAAAGCCACCGCGCAGCGGCCGGACGCGCTCGTGCTGGATGTCATGA
TGCCGCGGCTGGACGGGCTGGAGGTTTGCCGGCGTTTGCGCAGTACCGGTGACGATCTTCCGATTCTGGTTTTGACGGCG
CGGGATTCGGTTTCCGAAAGGGTTGCCGGGCTCGACGCGGGGGCCGACGATTATCTGCCCAAGCCATTCGCGCTGGAAGA
ATTGCTGGCCCGGCTGCGCGCCCTGTTGCGCCGTCGCGCGCCCGATCCGGGTGACACCTCCGAGACGTTGCGCTTCGCCG
ACCTATCGCTGGACCCGGTCACCCGCGAGGTCTCCCGCGGCGACCGCGCGATCAGCCTGACCCGCACCGAGTTCTCCCTG
CTCGAGATGCTGATGGCCAATCCGCGGCGGGTGCTGACCCGTAGCCGCATTCTCGAGGAGGTGTGGGGCTACGACTTCCC
CACCTCGGGTAACGCGCTCGAGGTCTACATCGGCTACCTGCGACGCAAGACCGAGGCCGAGGGCGAGCCGCGGCTGATCC
ACACCGTGCGCGGCGTCGGGTACGTGCTGCGCGAGACCCCGCCGTAG

Protein sequence :
MRILVVDDDRAVRESLRRSLTFNGYTVDLAVDGVDALEKATAQRPDALVLDVMMPRLDGLEVCRRLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARLRALLRRRAPDPGDTSETLRFADLSLDPVTREVSRGDRAISLTRTEFSL
LEMLMANPRRVLTRSRILEEVWGYDFPTSGNALEVYIGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-31 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
nfa49640 YP_121180.1 two-component system response regulator BAC0083 Protein 7e-36 48
nfa49640 YP_121180.1 two-component system response regulator BAC0125 Protein 8e-35 47
nfa49640 YP_121180.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-38 46
nfa49640 YP_121180.1 two-component system response regulator BAC0638 Protein 6e-30 46
nfa49640 YP_121180.1 two-component system response regulator BAC0308 Protein 9e-33 44
nfa49640 YP_121180.1 two-component system response regulator BAC0111 Protein 2e-34 44
nfa49640 YP_121180.1 two-component system response regulator BAC0197 Protein 9e-32 44
nfa49640 YP_121180.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-33 44
nfa49640 YP_121180.1 two-component system response regulator U82965.2.orf14.gene. Protein 6e-23 43
nfa49640 YP_121180.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-33 42
nfa49640 YP_121180.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-29 41
nfa49640 YP_121180.1 two-component system response regulator Y16952.3.orf35.gene. Protein 2e-24 41
nfa49640 YP_121180.1 two-component system response regulator BAC0347 Protein 6e-30 41
nfa49640 YP_121180.1 two-component system response regulator CP004022.1.gene3215. Protein 3e-24 41
nfa49640 YP_121180.1 two-component system response regulator NC_012469.1.7686381. Protein 9e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
nfa49640 YP_121180.1 two-component system response regulator VFG1390 Protein 3e-84 86
nfa49640 YP_121180.1 two-component system response regulator VFG1389 Protein 1e-44 54
nfa49640 YP_121180.1 two-component system response regulator VFG1386 Protein 3e-45 51
nfa49640 YP_121180.1 two-component system response regulator VFG0596 Protein 2e-32 44