Gene Information

Name : PBPRA0986 (PBPRA0986)
Accession : YP_129199.1
Strain :
Genome accession: NC_006370
Putative virulence/resistance : Virulence
Product : two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1088363 - 1089058 bp
Length : 696 bp
Strand : +
Note : -

DNA sequence :
TTGAAAATTCTCATTATTGAAGATGAAATAAAGGCAGGGCAATACCTAAAAAAAGGGTTGACCGAATCTGGCTATACTGT
TGATTTGGCGAGTGATGGTGTTGAGGGCCTATACCATGCAACCAGCCATAGTTACGATTTAATTATTCTCGACATCATGT
TGCCAAAACTGGATGGATGGCAAATTCTAAAAACATTGAGAAGCAGTGAAATGAGCACGCCTGTCATTATGCTTACGGCG
AAAGAGCAAGTAGAAGACCGAGTAAAAGGCTTTGAGCTTGGTGCAAATGACTACGTAGTGAAACCTTATGCGTTCCCTGA
ACTTTTGGCCCGTATTCAAAATGTATTTAGGAACCATTCACCGAAATCAAAAAATATTTCACAAAGTAATACCATAGTGA
TTGCTGATTTACAGCTGGATATTATCAAGCGTACTGCGACCAGAAATAATCAATCCATTACTCTTACTGCAAAAGAGTAT
TTGCTTTTGGAGTTGTTGATGCGCAAGCAGGGAGAAGTGCTCTCTCGCACTACTATTGCTTCTTTAGTATGGGACATGAA
CTTTGACAGCGATACCAATGTGATTGATGTTGCTGTCAAACGCCTGAGATCCAAAATTGATAGACCGTTTGAAAAGGAGT
TGATTCATACAATTCGAGGGATGGGCTATAAGTTAGAGGATATCGAAGAGCAATGA

Protein sequence :
MKILIIEDEIKAGQYLKKGLTESGYTVDLASDGVEGLYHATSHSYDLIILDIMLPKLDGWQILKTLRSSEMSTPVIMLTA
KEQVEDRVKGFELGANDYVVKPYAFPELLARIQNVFRNHSPKSKNISQSNTIVIADLQLDIIKRTATRNNQSITLTAKEY
LLLELLMRKQGEVLSRTTIASLVWDMNFDSDTNVIDVAVKRLRSKIDRPFEKELIHTIRGMGYKLEDIEEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-57 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-56 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0197 Protein 4e-62 58
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0111 Protein 8e-61 57
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0308 Protein 2e-58 56
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0125 Protein 7e-61 56
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0083 Protein 2e-60 55
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0638 Protein 6e-55 54
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein BAC0347 Protein 2e-54 52
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_007622.3794948.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_003923.1003417.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_013450.8614146.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_002951.3238224.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_007793.3914065.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_002758.1121390.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_010079.5776364.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein NC_002952.2859858.p0 Protein 5e-33 42
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein AE015929.1.gene1106. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein VFG0596 Protein 3e-57 54
PBPRA0986 YP_129199.1 two component response regulator transcription regulator protein VFG1389 Protein 1e-33 41