Gene Information

Name : rr05 (stu1160)
Accession : YP_139611.1
Strain : Streptococcus thermophilus LMG 18311
Genome accession: NC_006448
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1019684 - 1020391 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATTCTAGTTGTTGATGATGAAAGACCAATCTCCGATATCATCAAGTTTAACCTTACTAAGGAGGGTTATGA
AGTGGTTACGGCCTTTGATGGGCGAGAAGCTTTGGAACAATTTGAAGCTAAAAAACCAGACTTGGTTATTCTGGACTTGA
TGTTGCCTGAACTGGATGGTTTGGAAGTTGCCAAGGAAATCCGTAAAACGAGCCACACACCGATTATCATGCTTTCAGCT
AAAGATAGTGAGTTTGATAAGGTTATCGGATTAGAAATTGGGGCAGACGACTATGTGACTAAGCCATTTTCTAACCGTGA
ATTGTTGGCACGTATTAAAGCCCACTTGCGTCGTACAGAAACGATTGAAACTGCAGTAGAAGAGAGCTCTAACTCTGGCA
AACAAGAAATTTCAATTGGTGAGTTGATTATTGTTCCGGATGCCTTTGTTGCTAAAAAACGTGGAAACGAAGTTGAGTTG
ACCCACCGTGAATTTGAGTTACTCTTCCATTTGGCAACTCATATGGGACAAGTTATGACGCGTGAACATTTGCTTGAAAC
CGTTTGGGGCTATGACTATTTTGGGGATGTTCGTACTGTGGACGTAACGATTCGTCGTCTGCGTGAAAAAATTGAAGATA
CACCTAGCCGTCCTGAATATATCTTGACGCGTCGTGGTGTCGGTTATTACATGAAGAATTATGACTAG

Protein sequence :
MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKKPDLVILDLMLPELDGLEVAKEIRKTSHTPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRRTETIETAVEESSNSGKQEISIGELIIVPDAFVAKKRGNEVEL
THREFELLFHLATHMGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMKNYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-37 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr05 YP_139611.1 response regulator NC_012469.1.7685629. Protein 6e-90 81
rr05 YP_139611.1 response regulator NC_002952.2859905.p0 Protein 4e-55 54
rr05 YP_139611.1 response regulator NC_007622.3794472.p0 Protein 4e-55 54
rr05 YP_139611.1 response regulator NC_003923.1003749.p0 Protein 2e-55 54
rr05 YP_139611.1 response regulator NC_002758.1121668.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_009641.5332272.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_013450.8614421.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_007793.3914279.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_002745.1124361.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_009782.5559369.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator NC_002951.3237708.p0 Protein 3e-55 54
rr05 YP_139611.1 response regulator HE999704.1.gene2815. Protein 8e-56 54
rr05 YP_139611.1 response regulator AE016830.1.gene1681. Protein 1e-48 49
rr05 YP_139611.1 response regulator NC_012469.1.7686381. Protein 2e-46 49
rr05 YP_139611.1 response regulator AM180355.1.gene1830. Protein 1e-42 45
rr05 YP_139611.1 response regulator AE015929.1.gene1106. Protein 4e-37 44
rr05 YP_139611.1 response regulator NC_007622.3794948.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_003923.1003417.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_013450.8614146.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_002951.3238224.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_007793.3914065.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_002758.1121390.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_010079.5776364.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator NC_002952.2859858.p0 Protein 4e-41 43
rr05 YP_139611.1 response regulator CP001138.1.gene4273. Protein 1e-33 43
rr05 YP_139611.1 response regulator AF155139.2.orf0.gene Protein 2e-41 43
rr05 YP_139611.1 response regulator FJ349556.1.orf0.gene Protein 8e-43 43
rr05 YP_139611.1 response regulator DQ212986.1.gene4.p01 Protein 6e-40 43
rr05 YP_139611.1 response regulator BAC0533 Protein 5e-34 42
rr05 YP_139611.1 response regulator NC_002695.1.915041.p Protein 3e-34 42
rr05 YP_139611.1 response regulator CP000647.1.gene4257. Protein 5e-34 42
rr05 YP_139611.1 response regulator CP000034.1.gene3834. Protein 3e-34 42
rr05 YP_139611.1 response regulator CP004022.1.gene3215. Protein 1e-35 42
rr05 YP_139611.1 response regulator CP001918.1.gene5135. Protein 2e-28 42
rr05 YP_139611.1 response regulator NC_014475.1.orf0.gen Protein 4e-40 42
rr05 YP_139611.1 response regulator NC_005054.2598277.p0 Protein 4e-40 42
rr05 YP_139611.1 response regulator HE999704.1.gene1528. Protein 1e-37 41
rr05 YP_139611.1 response regulator AF162694.1.orf4.gene Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rr05 YP_139611.1 response regulator VFG1563 Protein 2e-37 44
rr05 YP_139611.1 response regulator VFG1702 Protein 2e-37 43
rr05 YP_139611.1 response regulator VFG1389 Protein 1e-33 43