Gene Information

Name : ebA2514 (ebA2514)
Accession : YP_158444.1
Strain : Aromatoleum aromaticum EbN1
Genome accession: NC_006513
Putative virulence/resistance : Virulence
Product : RadC family DNA repair protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 1513089 - 1513583 bp
Length : 495 bp
Strand : -
Note : -

DNA sequence :
ATGTCTCTCGTCATCGCCGACTCCCGCCCGGAGTCGCTCACCCTGCTCGCCGCCCAGCACGAAGACTGGATCATCCGGCA
GGCCATCACCCTGCTGGAGAACCGCGTGTTCAAGGCCGGTCCGGCGCTGGGCAGTCCCGCCGCCGTGCGCGACTACCTGC
GCCTGAAACTGGTCGCGGAGCCGAACGAAATCTTCGCCGTCGTGTTTCTCGACAACCAGCACCAGGTGCTCGCCTTTGAG
CCGCTGTTCAAGGGCACGGTCGACCAGACTTCGGTGTATCCGAGGGTGGTGGTCCAGCGTGCGCTGGCGCTCAACGCTTC
GGCGCTGATCCTGGCGCATCAGCACCCCTCGGGCAACACCGAGCCATCGGCGGCTGATCGTGCGATCACCGAGCGGCTGA
AGAGCGCCCTGGCCACCGTCGATGTCCGGGTGCTGGATCACTTCATCGTCGGCAAGGGCAGCCCGTACTCGTTCGCCGAA
GCCGGCTTGTTGTAG

Protein sequence :
MSLVIADSRPESLTLLAAQHEDWIIRQAITLLENRVFKAGPALGSPAAVRDYLRLKLVAEPNEIFAVVFLDNQHQVLAFE
PLFKGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADRAITERLKSALATVDVRVLDHFIVGKGSPYSFAE
AGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 3e-51 72
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 2e-38 62
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-26 54
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-26 54
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 9e-27 54
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 9e-25 53
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 6e-22 50
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 1e-21 50
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 6e-22 50
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-20 49
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 2e-21 49
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 1e-21 49
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 1e-21 49
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 5e-22 49
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 7e-22 49
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-22 49
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 7e-22 49
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 7e-22 49
unnamed AAL08475.1 unknown Not tested SRL Protein 1e-21 49
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 9e-22 49
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 9e-22 49
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 8e-22 49
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 8e-22 47
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 8e-22 47
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 6e-22 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ebA2514 YP_158444.1 RadC family DNA repair protein VFG1119 Protein 4e-27 54
ebA2514 YP_158444.1 RadC family DNA repair protein VFG1617 Protein 4e-22 50
ebA2514 YP_158444.1 RadC family DNA repair protein VFG1528 Protein 4e-22 49
ebA2514 YP_158444.1 RadC family DNA repair protein VFG1678 Protein 9e-23 49
ebA2514 YP_158444.1 RadC family DNA repair protein VFG1066 Protein 5e-22 49
ebA2514 YP_158444.1 RadC family DNA repair protein VFG0660 Protein 2e-22 47