Gene Information

Name : syc0104_c (syc0104_c)
Accession : YP_170814.1
Strain : Synechococcus elongatus PCC6301
Genome accession: NC_006576
Putative virulence/resistance : Virulence
Product : two-component response regulator for energy transfer from phycobilisomes to photosystems
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 113664 - 114320 bp
Length : 657 bp
Strand : -
Note : OmpR subfamily

DNA sequence :
ATGATTGGTTACGAAGTTGTCACCGCAGCCGACGGCGAAGAAGCCCTCATCACCTTCCGCAATGCTACGCCGGATCTCGT
GGTGCTCGATGTGATGATGCCCAAGCTCGATGGCTATGGCGTTTGCCAAGAGCTGCGCAAAGAGTCGGACGTTCCGATCA
TCATGCTGACAGCCTTGGGCGATGTGGCCGATCGCATTACGGGGCTTGAGTTGGGAGCTGATGACTACGTCGTCAAACCC
TTCTCGCCTAAGGAACTAAAAGCGCGAGTCCGCTCGGTGCTGCGTCGGGTCGAAAAAAGCGGTGCTAATGGCATCCCCAG
TTCGGGCGTCATCCAGATCAACAGCATCCGCATCGACACCAATAAGCGCCAAGTCTACAAAGGCGATGAGCGCATCCGTC
TGACGGGCATGGAGTTCAGTTTGTTGGAACTGCTGGTCAGCCGCTCCGGTGAACCTTTTAGCCGCGCCGAAATCCTGCAA
GAGGTCTGGGGCTATACCCCCGAGCGCCACGTCGATACCCGCGTAGTCGATGTCCACATCTCGCGGCTGCGCGCCAAATT
GGAAGACGATCCGGGCAACCCTGAGCTCATTCTGACGGCCCGAGGAACCGGCTACCTCTTCCAACGCATCGTTGAACCGG
GCGAAGAAGGGCGTTAG

Protein sequence :
MIGYEVVTAADGEEALITFRNATPDLVVLDVMMPKLDGYGVCQELRKESDVPIIMLTALGDVADRITGLELGADDYVVKP
FSPKELKARVRSVLRRVEKSGANGIPSSGVIQINSIRIDTNKRQVYKGDERIRLTGMEFSLLELLVSRSGEPFSRAEILQ
EVWGYTPERHVDTRVVDVHISRLRAKLEDDPGNPELILTARGTGYLFQRIVEPGEEGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-28 43
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 6e-31 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002952.2859905.p0 Protein 2e-42 52
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_007622.3794472.p0 Protein 2e-42 52
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_013450.8614421.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_007793.3914279.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_003923.1003749.p0 Protein 3e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002745.1124361.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_009782.5559369.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002951.3237708.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002758.1121668.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_009641.5332272.p0 Protein 2e-42 51
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_012469.1.7685629. Protein 2e-38 47
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems BAC0197 Protein 1e-30 47
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems AE000516.2.gene3505. Protein 5e-39 46
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems BAC0125 Protein 7e-35 45
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems BAC0083 Protein 1e-33 44
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems HE999704.1.gene2815. Protein 5e-36 44
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems BAC0638 Protein 1e-25 43
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems CP001918.1.gene5135. Protein 6e-26 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_010400.5986590.p0 Protein 7e-36 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_011595.7057856.p0 Protein 1e-35 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_010410.6002989.p0 Protein 1e-35 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems CP000675.2.gene1535. Protein 1e-35 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems BAC0308 Protein 9e-32 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems HE999704.1.gene1528. Protein 6e-27 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems CP000034.1.gene3671. Protein 2e-34 42
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_003923.1003417.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_013450.8614146.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002951.3238224.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_007793.3914065.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002758.1121390.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_010079.5776364.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_002952.2859858.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems NC_007622.3794948.p0 Protein 2e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems CP004022.1.gene3215. Protein 5e-31 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems CP001485.1.gene721.p Protein 1e-30 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems DQ212986.1.gene4.p01 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems VFG0596 Protein 4e-29 44
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems VFG1389 Protein 1e-32 44
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems VFG1390 Protein 3e-35 43
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems VFG1563 Protein 5e-35 41
syc0104_c YP_170814.1 two-component response regulator for energy transfer from phycobilisomes to photosystems VFG1386 Protein 1e-31 41