Gene Information

Name : syc2221_c (syc2221_c)
Accession : YP_172931.1
Strain : Synechococcus elongatus PCC6301
Genome accession: NC_006576
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2370973 - 2371653 bp
Length : 681 bp
Strand : -
Note : OmpR subfamily and rre28 homolog

DNA sequence :
ATGAACAATCATATTTTGCTCATTGAGGATGACCCGAAGCTTCTGCTGTTTGTTGAGCAAGAACTCAGCTTAGAAGGCTA
TCAAGTAACAGTTGCCAACAACGGTCTAGACGGTCTATCTTTAGCAAGAAGTATTCAACCCGATTTACTCATTCTGGACT
GGATGTTACCAACTCTTTCTGGAGTTGATATCTGCTTGAGGCTACGATCGACTGGTGTTCAAACACCAATCATTTTATTG
ACAGCTAAGGATGAAATTTCCGATCGCGTTTCGGGGTTAAACTCAGGGGCTGATGACTATGTCACAAAGCCCTTCAGCAT
CGAGGAGCTGCTGGCACGAGTTAAGGCGCAATTACGTCGGGTCAATCCAGAAGAGCCCGATCGCCTGCAGTTTGCTGATG
TATCACTCCATCGTCTAACCCATGAAGTTTATCGAGGGAGTCAACGACTAGAGCTGACAGCTAAGGAGTTTGATCTGCTC
GAGTTTCTCCTAAGACATGCTCGACAAGTCGTTACCCGTGACCAAATTCTTGAGCAAGTTTGGGGGTATGACTTCATGGG
CGAGTCTAATATTATTGAAGTCTATATTCGAGCATTGCGATTAAAGCTAGAAGCCTCAAATCCGCAACGAATTTTACAGA
CAGTGCGAGGCGTTGGCTATGTGATTCGCGACTATCCCTAA

Protein sequence :
MNNHILLIEDDPKLLLFVEQELSLEGYQVTVANNGLDGLSLARSIQPDLLILDWMLPTLSGVDICLRLRSTGVQTPIILL
TAKDEISDRVSGLNSGADDYVTKPFSIEELLARVKAQLRRVNPEEPDRLQFADVSLHRLTHEVYRGSQRLELTAKEFDLL
EFLLRHARQVVTRDQILEQVWGYDFMGESNIIEVYIRALRLKLEASNPQRILQTVRGVGYVIRDYP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
syc2221_c YP_172931.1 two-component response regulator AE015929.1.gene1106. Protein 1e-40 46
syc2221_c YP_172931.1 two-component response regulator HE999704.1.gene1528. Protein 5e-40 46
syc2221_c YP_172931.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-43 45
syc2221_c YP_172931.1 two-component response regulator BAC0347 Protein 5e-36 44
syc2221_c YP_172931.1 two-component response regulator BAC0111 Protein 8e-38 44
syc2221_c YP_172931.1 two-component response regulator AE000516.2.gene3505. Protein 4e-37 44
syc2221_c YP_172931.1 two-component response regulator BAC0125 Protein 2e-42 43
syc2221_c YP_172931.1 two-component response regulator BAC0083 Protein 2e-39 43
syc2221_c YP_172931.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-40 43
syc2221_c YP_172931.1 two-component response regulator NC_012469.1.7685629. Protein 6e-35 42
syc2221_c YP_172931.1 two-component response regulator AE016830.1.gene1681. Protein 1e-41 42
syc2221_c YP_172931.1 two-component response regulator BAC0308 Protein 2e-38 42
syc2221_c YP_172931.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-40 42
syc2221_c YP_172931.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-40 42
syc2221_c YP_172931.1 two-component response regulator NC_012469.1.7686381. Protein 3e-43 41
syc2221_c YP_172931.1 two-component response regulator BAC0638 Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
syc2221_c YP_172931.1 two-component response regulator VFG1390 Protein 2e-52 48
syc2221_c YP_172931.1 two-component response regulator VFG0596 Protein 4e-35 45
syc2221_c YP_172931.1 two-component response regulator VFG1389 Protein 2e-38 41