Name : spaQ (SC2821) Accession : YP_217808.1 Strain : Salmonella enterica SC-B67 Genome accession: NC_006905 Putative virulence/resistance : Virulence Product : surface presentation of antigens; secretory proteins Function : - COG functional category : U : Intracellular trafficking, secretion and vesicular transport COG ID : COG4794 EC number : - Position : 2986913 - 2987173 bp Length : 261 bp Strand : - Note : IPR000595: Cyclic nucleotide-binding domain; IPR002191: Bacterial export protein FliQ, family 3; IPR006306: Type III secretion protein HrpO DNA sequence : ATGGATGATTTAGTGTTTGCAGGTAATAAGGCGCTCTATCTTGTTTTGATCCTGTCAGGGTGGCCGACGATTGTCGCAAC GATTATCGGCCTCCTGGTAGGGTTATTCCAGACGGTAACGCAATTACAGGAACAGACGCTGCCTTTTGGCATTAAATTAC TTGGCGTGTGTTTATGCTTGTTTTTACTGTCTGGCTGGTATGGCGAAGTTTTACTCTCTTACGGGCGTCAGGTGATATTC CTGGCGTTGGCTAAGGGGTAA Protein sequence : MDDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLFLLSGWYGEVLLSYGRQVIF LALAKG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 3e-27 | 100 |
spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 3e-27 | 100 |
spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 3e-27 | 100 |
spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 3e-27 | 100 |
spaQ | AAS66866.1 | SpaQ | Not tested | SSR-2 | Protein | 7e-20 | 71 |
ECs3724 | NP_311751.1 | EpaQ | Not tested | LIM | Protein | 2e-18 | 69 |
epaQ | AAZ31292.1 | EpaQ | Virulence | ETT2 | Protein | 2e-18 | 68 |
ysaS | AAS66847.1 | YsaS | Not tested | SSR-1 | Protein | 5e-11 | 54 |
hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 2e-08 | 50 |
hrcS | AAT96263.1 | HrcS | Virulence | S-PAI | Protein | 8e-07 | 47 |
hrcS | AAT96304.1 | HrcS | Virulence | S-PAI | Protein | 8e-07 | 47 |
hrcS | AAT96344.1 | HrcS | Virulence | S-PAI | Protein | 8e-07 | 47 |
lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 1e-05 | 45 |
hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 2e-06 | 45 |
hrcS | ABQ88360.1 | HrcS | Virulence | Hrp PAI | Protein | 1e-04 | 41 |
hrcS | AAT96201.1 | HrcS | Virulence | T-PAI | Protein | 6e-07 | 41 |
hrpO | AAB05076.1 | HrpO | Virulence | Hrp PAI | Protein | 1e-04 | 41 |
hrcS | AAT96147.1 | HrcS | Virulence | T-PAI | Protein | 6e-07 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG0550 | Protein | 8e-28 | 100 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG1013 | Protein | 4e-19 | 70 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG2454 | Protein | 3e-12 | 55 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG1772 | Protein | 2e-15 | 53 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG0187 | Protein | 8e-04 | 50 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG0395 | Protein | 6e-07 | 46 |
spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | VFG0043 | Protein | 9e-05 | 43 |