Gene Information

Name : Psyr_0987 (Psyr_0987)
Accession : YP_234081.1
Strain : Pseudomonas syringae B728a
Genome accession: NC_007005
Putative virulence/resistance : Unknown
Product : helix-turn-helix, Fis-type
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1117825 - 1118124 bp
Length : 300 bp
Strand : +
Note : -

DNA sequence :
ATGTCAAAACGTCAGTTTCCAACCGAGTTCAGACTTGAGGCTGCCCGCCTTGTTCTTGATGCCAATTATTCAACCGCTCA
GGCCTGCGAGGCTATGGGTGTCGGGGCAACAGCACTGCGCCGCTGGGTTGAACAGTTAAGGCAGGAGCGCGGGGGAGTAA
CGCCTGAAACGGCTAATGCCATGACCGCTGAACAACAACAGATCCAGGCTCTGCATGCCAAAATTCGCAAGCTTGAAATC
GAGAAGGAAATCCTAAAAAAGGCTACCGCTCTCTTGATGTCCGATTCCCTCGATCGGTGA

Protein sequence :
MSKRQFPTEFRLEAARLVLDANYSTAQACEAMGVGATALRRWVEQLRQERGGVTPETANAMTAEQQQIQALHAKIRKLEI
EKEILKKATALLMSDSLDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-17 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-16 57
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-16 57
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-16 57
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-17 57
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-16 57
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-17 57
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-17 57
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-17 57
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-17 57
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-17 57
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-16 56
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 6e-16 55
l7045 CAD33744.1 - Not tested PAI I 536 Protein 6e-16 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-13 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-15 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-15 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-15 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-15 50
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-13 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyr_0987 YP_234081.1 helix-turn-helix, Fis-type VFG1123 Protein 3e-17 57
Psyr_0987 YP_234081.1 helix-turn-helix, Fis-type VFG1485 Protein 3e-16 55
Psyr_0987 YP_234081.1 helix-turn-helix, Fis-type VFG1553 Protein 1e-13 52
Psyr_0987 YP_234081.1 helix-turn-helix, Fis-type VFG0784 Protein 2e-15 50