Gene Information

Name : XC_2612 (XC_2612)
Accession : YP_243681.1
Strain : Xanthomonas campestris 8004
Genome accession: NC_007086
Putative virulence/resistance : Virulence
Product : RadC family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 3151646 - 3152125 bp
Length : 480 bp
Strand : -
Note : -

DNA sequence :
ATGAAGCGCACCCAAGACCGAGCAGTCCAATATCAACTTGAGATGGACGAGGAGGGGATTCTCCTCGCTGCCGCGACCAT
CTTGGAACAGCGCCTTCAACGCCAAGGCCGCATCCACAGCCCCGACCAAGCCGGCGACTACCTGGTTGCCCGCTGCGCTC
ACCTGCCGCACGAAGTCTTCGGGGTCGTCTTCCTCGACACCAAGCATCACATCCTCGCAACCGAACATCTCTTCAGCGGC
ACCATCGACGGGTGCGATGTCCACCCGCGAGTCGTAGCAAAGCGTGCCCTGGACCTCAACGCCGTCGCCGTCATCCTCTT
CCACAACCACCCGAGCGGGAATCCAGAGCCCAGCGAAGCCGACCGCAAAGTCACCGAGCGCCTGAAGCAGGCGCTGGCGC
TGCTCGACATCCGCGTCCTCGACCACCTGGTCATCGGCGGTCGGCAGCACACCAGCCTGGCCGCAAGGGGGTGGGTATAG

Protein sequence :
MKRTQDRAVQYQLEMDEEGILLAAATILEQRLQRQGRIHSPDQAGDYLVARCAHLPHEVFGVVFLDTKHHILATEHLFSG
TIDGCDVHPRVVAKRALDLNAVAVILFHNHPSGNPEPSEADRKVTERLKQALALLDIRVLDHLVIGGRQHTSLAARGWV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 5e-30 52
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 5e-30 52
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 3e-30 52
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 7e-22 49
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 7e-23 48
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 8e-23 48
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 2e-25 48
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 3e-22 47
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 8e-23 47
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 8e-23 47
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 6e-23 47
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 5e-23 47
unnamed AAL08475.1 unknown Not tested SRL Protein 1e-22 47
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 7e-23 46
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 3e-22 46
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 1e-22 46
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 8e-23 46
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 7e-23 46
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 8e-27 45
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 4e-21 45
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-21 45
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-21 45
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-21 45
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 4e-23 43
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 3e-23 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XC_2612 YP_243681.1 RadC family protein VFG1119 Protein 1e-30 52
XC_2612 YP_243681.1 RadC family protein VFG1678 Protein 3e-22 49
XC_2612 YP_243681.1 RadC family protein VFG0660 Protein 2e-23 47
XC_2612 YP_243681.1 RadC family protein VFG1066 Protein 5e-23 47
XC_2612 YP_243681.1 RadC family protein VFG1528 Protein 3e-23 46
XC_2612 YP_243681.1 RadC family protein VFG1617 Protein 1e-22 46