Gene Information

Name : tcsR5 (jk1532)
Accession : YP_251323.1
Strain : Corynebacterium jeikeium K411
Genome accession: NC_007164
Putative virulence/resistance : Virulence
Product : two-component system response regulator TcsR5
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1806056 - 1806751 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTCTTGTTGTAGATGATGACCAGGCTGTGCGCGAATCCCTGCGCCGTTCCCTGATCTTCAACGGCTACACCGT
CATCCTGGCAACGGATGGCGAGGAGGCCCTTAAGCTCATCGCCGAAGAACGACCGGACTTGGCCATCCTGGACGTAATGA
TGCCCAAGAAGGACGGCCTGGACGTGTGCCGCGAACTACGCAGCCACGGAGACGACCTACCGATCCTGTTGTTGACCGCC
CGCGATTCCGTGGAGGAGCGAGTGGCCGGCCTGGATGCCGGTGCTGACGATTACCTGCCCAAGCCTTTCGCCCTTGAGGA
GCTGCTGGCCCGCACCCGTTCGCTGTTCCGCCGCGCTGCCCGTCCGGCGATTCAGGAAGGCGAAACCCGCGAGCCGCTGC
GCTTTGAAGACCTGACCCTGAACCCGGAGACGCGCGACGTTTTCCGCGGTGACCGCCAGATCAGCTTGACCCGCACGGAG
TTTGCCTTGCTGGAGCTGCTGATGAACAATCCGCGTAAGGTGCTTTCCCGCAACACCATCTTGGAAGAGGTGTGGGGTTA
TGACTTCCCAACCTCCGGCAACGCGCTAGAGGTTTACATTGGCTATCTGCGCCGTAAGACGGAGGCTAACAACGAGACTC
GATTGATTCACACTGTTCGTGGGGTGGGGTACGCGCTGCGTGAGACCGCACCGTGA

Protein sequence :
MKILVVDDDQAVRESLRRSLIFNGYTVILATDGEEALKLIAEERPDLAILDVMMPKKDGLDVCRELRSHGDDLPILLLTA
RDSVEERVAGLDAGADDYLPKPFALEELLARTRSLFRRAARPAIQEGETREPLRFEDLTLNPETRDVFRGDRQISLTRTE
FALLELLMNNPRKVLSRNTILEEVWGYDFPTSGNALEVYIGYLRRKTEANNETRLIHTVRGVGYALRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0083 Protein 7e-40 46
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0125 Protein 2e-40 45
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0347 Protein 1e-36 43
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0111 Protein 3e-40 43
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0197 Protein 9e-35 43
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0638 Protein 2e-33 43
tcsR5 YP_251323.1 two-component system response regulator TcsR5 HE999704.1.gene1528. Protein 5e-37 42
tcsR5 YP_251323.1 two-component system response regulator TcsR5 CP004022.1.gene3215. Protein 1e-32 42
tcsR5 YP_251323.1 two-component system response regulator TcsR5 AE000516.2.gene3505. Protein 9e-34 42
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0308 Protein 3e-36 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 CP001918.1.gene5135. Protein 2e-24 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 BAC0533 Protein 5e-27 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 CP000647.1.gene4257. Protein 5e-27 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_002952.2859905.p0 Protein 3e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_007793.3914279.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_002745.1124361.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_009782.5559369.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_002951.3237708.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_003923.1003749.p0 Protein 4e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_002758.1121668.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_007622.3794472.p0 Protein 3e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_009641.5332272.p0 Protein 5e-42 41
tcsR5 YP_251323.1 two-component system response regulator TcsR5 NC_013450.8614421.p0 Protein 5e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR5 YP_251323.1 two-component system response regulator TcsR5 VFG1390 Protein 2e-80 75
tcsR5 YP_251323.1 two-component system response regulator TcsR5 VFG1386 Protein 4e-50 49
tcsR5 YP_251323.1 two-component system response regulator TcsR5 VFG1389 Protein 8e-46 48
tcsR5 YP_251323.1 two-component system response regulator TcsR5 VFG0596 Protein 3e-38 43