Gene Information

Name : rpmE2 (SH0915)
Accession : YP_252830.1
Strain : Staphylococcus haemolyticus JCSC1435
Genome accession: NC_007168
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0254
EC number : -
Position : 923730 - 923987 bp
Length : 258 bp
Strand : +
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGAGACAAGGAATCCATCCTGATTATCACAAAGTTATCTTTTTAGATACAACTACTAACTTTAAATTTTTAAGTGGTTC
AACTAAAACATCTTCAGAAACAATGGAATGGGAAGATGGTAATGAATACCCAGTTATTCGTTTAGATGTATCTTCTGATT
CACACCCATTCTACACAGGACGTCAAAAATTCGCTGCTGCGGATGGTCGTGTGGAACGTTTCAACAAAAAGTTTGGTCTC
AAATCAAACAACAACTAA

Protein sequence :
MRQGIHPDYHKVIFLDTTTNFKFLSGSTKTSSETMEWEDGNEYPVIRLDVSSDSHPFYTGRQKFAAADGRVERFNKKFGL
KSNNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 7e-12 46
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 7e-12 46