Gene Information

Name : Psyc_0761 (Psyc_0761)
Accession : YP_264048.1
Strain : Psychrobacter arcticus 273-4
Genome accession: NC_007204
Putative virulence/resistance : Resistance
Product : tellurium resitance protein TerZ
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 910065 - 910673 bp
Length : 609 bp
Strand : -
Note : Bacterial stress protein

DNA sequence :
ATGGCAGTTAGTTTACAAAAGGGTCAAAAAATCTCCCTAAGCAAAGAAGCTGGCGGCGATCTTACCCAAGTAAAATTAGG
TCTAGGCTGGGATGTTGCCCAAGCTCCACAAGATAAAAAAGGTGGGTTTTTAGGTAAATTGTTCGGCGGCGGTAGTGGCG
GCGATTCTATCGATTTAGATGCGTCATGCATCATGTTTGATAGCAACAAACAGCCAGTGGATGCCATTTGGTTTAGCCAA
TTAAAATCAAAAGATGGCAGTATCGTGCACACTGGTGATAACCGCACCGGTGACGGCGATGGTGACGATGAAGTGATCAA
TGTTGATTTATCAAAAGTCCCAGCTAACGTAGTGTCCTTGGTATTTACCGTGAACAGCTTTACTGGTCAGACGTTTGAGA
CAGTAGAAAATGCGTTTTGCCGTATCGTCAATGCCAATAACAATACTGAAGTAGCACGCTATAATTTGTCGTCGCAAGGT
ACTCATACAGCGATGATTATGGCAAAAGTTTACCGCCATAATAATGAGTGGAAAATGCATGCCATCGGTGAAACGGCGAC
TGGTCGTACTTTCCATGACTTGATGCCTGCTATCACCCCGCATGCTTAA

Protein sequence :
MAVSLQKGQKISLSKEAGGDLTQVKLGLGWDVAQAPQDKKGGFLGKLFGGGSGGDSIDLDASCIMFDSNKQPVDAIWFSQ
LKSKDGSIVHTGDNRTGDGDGDDEVINVDLSKVPANVVSLVFTVNSFTGQTFETVENAFCRIVNANNNTEVARYNLSSQG
THTAMIMAKVYRHNNEWKMHAIGETATGRTFHDLMPAITPHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-42 55
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-35 48
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-35 48
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-27 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-22 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-23 42
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 42
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyc_0761 YP_264048.1 tellurium resitance protein TerZ BAC0392 Protein 2e-35 48
Psyc_0761 YP_264048.1 tellurium resitance protein TerZ BAC0389 Protein 6e-24 42