|
Name : rplY (BPEN_488) Accession : YP_277980.1 Strain : Candidatus Blochmannia pennsylvanicus BPEN Genome accession: NC_007292 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L25 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG1825 EC number : - Position : 583227 - 583520 bp Length : 294 bp Strand : + Note : the Ctc family of proteins consists of two types, one that contains the N-terminal ribosomal protein L25 domain only which in Escherichia coli binds the 5S rRNA while a subset of proteins contain a C-terminal extension that is involved in the stress respo DNA sequence : ATGTTAACAATCAAAGCTAATTTACGTATTTATCACAAAAAAGGCGCAACAAGACGATTACGTAAACAAAACAAATGTCC AGCTGTTATCTACAATAGAGGCCAAGAACCAAGCATACCCATTATATTGAATCAAAACGATATTTTACATCCTGAAGCTG TAATACAATTATACAAAAATAATGTTATTCTATTGTTTATAGAAAATCAACAACCTATTACAGTCAAAGTGCAAGAACTA CAATATCATCCTTTCAAGTCCAAATTAATCCATATTGATTTTACACGTGTTTAA Protein sequence : MLTIKANLRIYHKKGATRRLRKQNKCPAVIYNRGQEPSIPIILNQNDILHPEAVIQLYKNNVILLFIENQQPITVKVQEL QYHPFKSKLIHIDFTRV |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ESA_01051 | YP_001437155.1 | 50S ribosomal protein L25 | Not tested | Not named | Protein | 5e-14 | 43 |
