Gene Information

Name : Daro_3146 (Daro_3146)
Accession : YP_286346.1
Strain : Dechloromonas aromatica RCB
Genome accession: NC_007298
Putative virulence/resistance : Virulence
Product : response regulator receiver:transcriptional regulatory protein, C-terminal
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3385439 - 3386143 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGAACACACGCATACTGCTTGTCGAAGACGACGAACGCCTGGCCGAACTGACGGCCGAATATCTGACCAAGAACGATCT
GGAAGTGAGCATCGAGCCCCGCGGCGACACCGCCGAAGCGCGCATTCTCGCCGAACAGCCCGACCTGGTGATTCTCGACG
TGATGTTGCCCGGCAAGGACGGCTTCGAGGTTTGTCGGGCGGTTCGCTCGCAATTCCGCGGCGTGATCCTGATGCTGACC
GCCCGTGATGAGGATTTCGACCAGATTCTCGGCCTGGAGATGGGTGCCGACGACTACATTGCCAAGCCGGTCCAGCCGCG
CGTCCTGCTTGCTCGCATCAAGGCCCTGCTGCGTCGATTGCCTGTGGCCGGCGAAGGCGGCAGCGGAGAATCGGAGAGCA
TGCTGTTCGGCCAGTTCAAGATCAGCCAGGCAACGCGAACCGCCGCACTGGCCGGCCAGACCATCGACCTGACCACGGCC
GAATTCGATCTGCTGTGGCTACTCGCCTCCCACGCCGGCAACGTACTGTCACGCGACGACCTGCTGCAGGAATTGCGCGG
TATCGGTTTCGATGGCCTGGATCGCTCCATTGACGCCCGAATTTCACGTCTGCGCAAGAAATTGAACGACGACCCGGAAA
ACCCGACCCGCATCAAGACCGTCCGTGGCAAGGGTTACCTGTTCAGCAAGCATGACTGGAACTGA

Protein sequence :
MNTRILLVEDDERLAELTAEYLTKNDLEVSIEPRGDTAEARILAEQPDLVILDVMLPGKDGFEVCRAVRSQFRGVILMLT
ARDEDFDQILGLEMGADDYIAKPVQPRVLLARIKALLRRLPVAGEGGSGESESMLFGQFKISQATRTAALAGQTIDLTTA
EFDLLWLLASHAGNVLSRDDLLQELRGIGFDGLDRSIDARISRLRKKLNDDPENPTRIKTVRGKGYLFSKHDWN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal CP000034.1.gene3671. Protein 1e-33 44
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002952.2859905.p0 Protein 9e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_009641.5332272.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_013450.8614421.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_007622.3794472.p0 Protein 1e-32 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_007793.3914279.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_003923.1003749.p0 Protein 8e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002745.1124361.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_009782.5559369.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002951.3237708.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002758.1121668.p0 Protein 7e-33 42
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_010400.5986590.p0 Protein 7e-28 41
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_011595.7057856.p0 Protein 1e-27 41
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_010410.6002989.p0 Protein 1e-27 41
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal HE999704.1.gene2815. Protein 2e-29 41
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal CP001918.1.gene3444. Protein 4e-25 41
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal CP001918.1.gene5135. Protein 8e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daro_3146 YP_286346.1 response regulator receiver:transcriptional regulatory protein, C-terminal VFG1563 Protein 5e-25 41