Gene Information

Name : PMN2A_1500 (PMN2A_1500)
Accession : YP_292691.1
Strain : Prochlorococcus marinus NATL2A
Genome accession: NC_007335
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 174504 - 175250 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGACGGCCACAAGTCCCTCAAAGGAAACCATCCTCGTAGCTGATGATGAGGCAAGTATTAGGAGGATCCTAGAAACTCG
CCTATCCATGATTGGCTATCAGGTAGTTACTGCTTGTGATGGAAATGAGGCTTTGGATCTTTTCAGGAATTGTGAGCCTG
ATTTGGTTGTACTCGATGTCATGATGCCTAAATTAGATGGATATGGAGTTTGCCAGGAACTAAGAAAGGAATCAGATGTT
CCGATAGTTATGCTGACAGCCTTGGGAGATGTTGCAGATAGAATTACTGGACTTGAGCTAGGTGCTGATGATTATGTTGT
TAAACCATTTAGCCCAAAAGAATTAGAAGCTAGAATCAGATGTGTATTAAGAAGGGTAGAGAAAGAACAAATAGCAGGAC
TTCCTAATTCAGGTGTCATTGCGGTTATGAATTTAAAGATTGATACAAATAAGCGTCAGGTTTATAGAAACGATGAACGA
ATTCGATTAACAGGTATGGAATTTAGTCTTTTAGAACTGTTGGTTAGTCGTTCAGGAGAACCTTTTAGTCGAGGTGAGAT
TCTTAAAGAAGTTTGGGGATATACCCCTGAAAGACATGTTGATACGAGAGTAGTGGATGTTCATATTTCTAGACTTAGAT
CAAAACTTGAGGATGATCCTGCAAATCCAGAACTAATACTTACTGCAAGAGGAACAGGTTATCTTTTTCAAAGAATTGTT
GACTCTATGATTCCTGAAGGATCATAA

Protein sequence :
MTATSPSKETILVADDEASIRRILETRLSMIGYQVVTACDGNEALDLFRNCEPDLVVLDVMMPKLDGYGVCQELRKESDV
PIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRRVEKEQIAGLPNSGVIAVMNLKIDTNKRQVYRNDER
IRLTGMEFSLLELLVSRSGEPFSRGEILKEVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLFQRIV
DSMIPEGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-45 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-45 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-44 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-40 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-41 47
PMN2A_1500 YP_292691.1 two component transcriptional regulator BAC0125 Protein 9e-38 45
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-41 44
PMN2A_1500 YP_292691.1 two component transcriptional regulator BAC0083 Protein 7e-34 43
PMN2A_1500 YP_292691.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-38 43
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-38 42
PMN2A_1500 YP_292691.1 two component transcriptional regulator BAC0197 Protein 3e-33 42
PMN2A_1500 YP_292691.1 two component transcriptional regulator BAC0638 Protein 5e-27 42
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-35 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator CP004022.1.gene3215. Protein 7e-33 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-24 41
PMN2A_1500 YP_292691.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PMN2A_1500 YP_292691.1 two component transcriptional regulator VFG1390 Protein 4e-38 44
PMN2A_1500 YP_292691.1 two component transcriptional regulator VFG1389 Protein 1e-30 43
PMN2A_1500 YP_292691.1 two component transcriptional regulator VFG0596 Protein 5e-33 42