Gene Information

Name : SSPP111 (SSPP111)
Accession : YP_302547.1
Strain :
Genome accession: NC_007351
Putative virulence/resistance : Resistance
Product : putative site-specific recombinase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG1961
EC number : -
Position : 11119 - 11670 bp
Length : 552 bp
Strand : -
Note : similar to gi|17227227|ref|NP_478393.1| [Staphylococcus aureus], percent identity 88 in 180 aa, BLASTP E(): 3e-88

DNA sequence :
ATGGCTAAAATTGGTTATGCACGTGTATCAACACAAGATCAAAGTCTTGATGGACAAATTGATACACTTAAAGACTATGG
TTGTGAACGTATCTTTAGCGAAAAAGTGAGTGGTCGCAAAACGAAAAGAACAGAACTTGATAAGTGTTTAGACTATTTAC
GTGAAGGAGACATCCTAGTTATCTATAAATTAGATCGTCTTGGACGTACAACAAAACAATTAATTGATCTGTCTCAATGG
TTAGATGAAAACGGCATTGATTTACATATTATTGATATGAATGTGTCAACCAAAGATGCGATGGGAAAAATGTTTTTTAC
AATGATGAGTGCATTTGCAGAACTTGAAGCTAACTTATTAAGTGAACGTACGAAAAAAGGTCTAGAAGCTGCGAGAGCAA
GAGGGAGAAAAGGCGGCCGTCCTTCTTTGCCAGATTATAAGAAAAGAGAAATCAAATTCTTATACGATGAACAAAAACTT
ACAGGCGAAGAGATTGCTAAACAGACAGATGTTAGTCGTTCAACGGTATACAGAATAATAAAAAATAATTAG

Protein sequence :
MAKIGYARVSTQDQSLDGQIDTLKDYGCERIFSEKVSGRKTKRTELDKCLDYLREGDILVIYKLDRLGRTTKQLIDLSQW
LDENGIDLHIIDMNVSTKDAMGKMFFTMMSAFAELEANLLSERTKKGLEAARARGRKGGRPSLPDYKKREIKFLYDEQKL
TGEEIAKQTDVSRSTVYRIIKNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
binR YP_254224.1 resolvase/integrase BinR Not tested ¥ðSh1 Protein 8e-24 45
binL YP_254524.1 DNA-invertase Not tested ¥ðSh2 Protein 1e-23 45
SH1761 YP_253676.1 DNA-invertase Not tested ¥ÕSh1 Protein 1e-23 45
res AGF34985.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGF35025.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGF35059.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGK06929.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGK06966.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGK07012.1 resolvase Not tested SGI1 Protein 1e-25 43
res AGK07070.1 resolvase Not tested SGI1 Protein 1e-25 43
res AAK02044.1 resolvase Not tested SGI1 Protein 1e-25 43
tnpR ACD85600.1 TnpR resolvase Not tested SGI2 Protein 1e-25 43
tnpR ACK44544.1 Tn2 resolvase Not tested SGI1 Protein 8e-18 42
tnpR AGK07036.1 Tn2 resolvase Not tested SGI1 Protein 8e-18 42
tnpR AGK07094.1 Tn2 resolvase Not tested SGI1 Protein 8e-18 42
tnpR ACF06167.1 resolvase Not tested Tn5036-like Protein 2e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSPP111 YP_302547.1 putative site-specific recombinase GU371926.1.gene95.p0 Protein 1e-17 42