Gene Information

Name : Tbd_1749 (Tbd_1749)
Accession : YP_315507.1
Strain : Thiobacillus denitrificans ATCC 25259
Genome accession: NC_007404
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1840147 - 1840875 bp
Length : 729 bp
Strand : +
Note : -

DNA sequence :
GTGGCAGGATGCGGGCTCTTCCCAGGGTTTTACGTCATGAAAATTCTGATCGTCGAAGACGAGCCCAAAACGGGCGCTTA
CCTCAGGCAAGGGCTCACCGAAGCCGGCTTCGTCACCGATCTCGCCCGCGACGGGTGGGACGGACTGGAACTCGCCAAGT
CCGGGCATTACGACCTCATGATTCTCGACGTCATGTTGCCCGGTCTCGACGGCTGGCAGGTGCTCGAAGGCGTGCGCCGC
GCTGGCATCGGTACGCCGGTGCTGTTCCTGACCGCGCGCGATCGCGTCGAAGACCGGGTCAAGGGGCTGGAACTCGGCGC
CGACGACTATCTCGTGAAGCCCTTCGCCTTTGCCGAACTGCTCGCCCGCGTCCACAGCCTGATGCGCCGCGGGCAGGCCG
CCCTCGAGTCGGCCGTGCTCAAGGCGGCGGACCTCGAACTCGATCTGCTGCGCCGCCGCGCGACCCGCGCGGGCCGCCGG
ATCGATCTCACGGCCAAGGAATTCGCCCTGCTCGAACTGTTTCTTCGCCGTAAAGGCGAAGTGTTGCCGCGTAGCCTGAT
CGCATCCCAGGTGTGGGACATGAATTTCGACTCGGACACCAATGTCATCGACGTCGCGGTGCGGCGGCTGCGCGTCAAGA
TCGACGAAGGCTTCGACGCCAAACTCATCCACACCGTGCGCGGCATGGGTTACGTGCTGGAGACGAGCGCGGAAAGCGCA
GCTTCATGA

Protein sequence :
MAGCGLFPGFYVMKILIVEDEPKTGAYLRQGLTEAGFVTDLARDGWDGLELAKSGHYDLMILDVMLPGLDGWQVLEGVRR
AGIGTPVLFLTARDRVEDRVKGLELGADDYLVKPFAFAELLARVHSLMRRGQAALESAVLKAADLELDLLRRRATRAGRR
IDLTAKEFALLELFLRRKGEVLPRSLIASQVWDMNFDSDTNVIDVAVRRLRVKIDEGFDAKLIHTVRGMGYVLETSAESA
AS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-50 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-61 71
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-57 70
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-60 67
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0111 Protein 9e-62 66
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0308 Protein 7e-61 64
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-56 62
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-54 61
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-23 44
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-29 41
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-51 55
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-34 45
Tbd_1749 YP_315507.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-27 45