Gene Information

Name : Pfl01_3855 (Pfl01_3855)
Accession : YP_349583.1
Strain : Pseudomonas fluorescens Pf0-1
Genome accession: NC_007492
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4356235 - 4356915 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACCAACCCAAAACCGGCCAGTACCTGCGCCAGGGCCTGACCGAGGCCGGTTTCAACAC
CGAACTGGTGGCCGACGGCACCACCGGCCAGCAATTGGCGTTGAGTGGCGACTATGCGCTGCTGATCCTCGATGTGATGC
TGCCCGGACGCAATGGCTGGCAGATCCTGCAGGCGGTGCGCAGCGCCGGCCTGGAAACACCGATCCTGTTTTTGACCGCC
AAGGACACCGTGGAAGATAGGGTTCACGGCCTCGAACTGGGCGCCGACGACTACCTGGTCAAACCGTTCGCTTTCTCCGA
ACTGCTGGCGCGGGTGCGCAGCCTGTTACGCCGCGGCAGTTCCACGCCCCAGGAAACCAGCCTGCGCCTGGCCGATCTGA
GTCTGGATCTGATCCGCCGCCGGGTCGAACGCAGCGGTCAACGCATCGACCTCACCGCCAAAGAGTTCGCCCTGCTGGAA
ATGCTCCTGCGCCGTCAGGGCGAAGTGCTGCCCAAGTCACTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
CACCAATGTGATCGAAGTGGCGATTCGTCGACTGCGCCTGAAGATCGATGACGACTTCCCCAACAAGCTGATCCACACCG
TACGCGGCATGGGTTACGTCCTTGAAGAGCGTGCCGACTGA

Protein sequence :
MKLLIVEDQPKTGQYLRQGLTEAGFNTELVADGTTGQQLALSGDYALLILDVMLPGRNGWQILQAVRSAGLETPILFLTA
KDTVEDRVHGLELGADDYLVKPFAFSELLARVRSLLRRGSSTPQETSLRLADLSLDLIRRRVERSGQRIDLTAKEFALLE
MLLRRQGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRLKIDDDFPNKLIHTVRGMGYVLEERAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-57 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-70 71
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-75 70
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-71 67
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-70 66
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-68 63
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-65 61
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-66 60
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 9e-29 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 41
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator VFG0596 Protein 7e-58 56
Pfl01_3855 YP_349583.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-42 45