Gene Information

Name : Pcar_3081 (Pcar_3081)
Accession : YP_006718877.1
Strain : Pelobacter carbinolicus DSM 2380
Genome accession: NC_007498
Putative virulence/resistance : Virulence
Product : winged-helix transcriptional response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3594200 - 3594871 bp
Length : 672 bp
Strand : +
Note : 'domains: REC, trans_reg_C'

DNA sequence :
ATGCGTGTACTCGTGGTAGAAGACGAAAAAAAAGTAGCCAGCTTTATCAAACGGGGTCTGGAAGAGGAAGACTTCACCGT
AGATGTAGCCTTTGATGGTGAAGAGGGGCTCTACCTGGCTGAAAATAATCCTTACGATATCATCCTGATGGACCTCATGC
TGCCCAAGAAAGACGGCCTTGAAGTCATCAAGGAATTGCGAACCAAGGACGTAACCACTCCGGTATTGTGCCTGACCGCC
AAGGACGCTGTTGAAGATATCGTCTCCGGCCTCGATTCGGGCAGCGACGACTATCTGACCAAGCCCTTTGCCTTCAGCGA
ACTGCTGGCTCGCGTCAAAGCCCTGCTGCGGCGCAGCGCCAAGGATCGTGGTGCGGAGATCTATTTTGCCGACCTGCGCC
TTGACCCTGTTTCGCACAAGGTCTGGCGATCCGATCAGGAGATCGATCTGACAGCCAAGGAATACGCTTTGCTCGAATAC
TTCATGCGCAATCCCAATCAGGTGCTCACCCGGGCCATGATCGCCGAGCACGTATGGGACTACACCTTCGATTCTTTCAC
CAATATCATCGATGTGTATGTCAATTACCTGCGCAAGAAAGTCGACCGGGATTTCGACAAAAAGCTTATTCACACCGTGC
GCGGCGTGGGGTACGTCCTCAAGGAGGGCTGA

Protein sequence :
MRVLVVEDEKKVASFIKRGLEEEDFTVDVAFDGEEGLYLAENNPYDIILMDLMLPKKDGLEVIKELRTKDVTTPVLCLTA
KDAVEDIVSGLDSGSDDYLTKPFAFSELLARVKALLRRSAKDRGAEIYFADLRLDPVSHKVWRSDQEIDLTAKEYALLEY
FMRNPNQVLTRAMIAEHVWDYTFDSFTNIIDVYVNYLRKKVDRDFDKKLIHTVRGVGYVLKEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-44 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-43 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0111 Protein 4e-51 52
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0125 Protein 1e-50 51
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0308 Protein 3e-47 50
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0638 Protein 5e-42 50
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0197 Protein 2e-45 49
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0347 Protein 3e-44 48
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator BAC0083 Protein 9e-48 48
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator AE015929.1.gene1106. Protein 5e-36 44
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator HE999704.1.gene1528. Protein 6e-35 44
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_003923.1003417.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_013450.8614146.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002951.3238224.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_007793.3914065.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002758.1121390.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_010079.5776364.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002952.2859858.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_007622.3794948.p0 Protein 8e-40 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002952.2859905.p0 Protein 6e-38 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_007622.3794472.p0 Protein 7e-38 43
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_013450.8614421.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_007793.3914279.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002745.1124361.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_009782.5559369.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002951.3237708.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_003923.1003749.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_002758.1121668.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_009641.5332272.p0 Protein 9e-38 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator U82965.2.orf14.gene. Protein 4e-30 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_012469.1.7685629. Protein 1e-30 41
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator NC_012469.1.7686381. Protein 8e-38 41
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator AE016830.1.gene1681. Protein 1e-38 41
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator HE999704.1.gene2815. Protein 9e-33 41
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator AE000516.2.gene3505. Protein 9e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator VFG1390 Protein 1e-52 48
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator VFG0596 Protein 2e-44 45
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator VFG1389 Protein 4e-40 42
Pcar_3081 YP_006718877.1 winged-helix transcriptional response regulator VFG1386 Protein 4e-47 41