Gene Information

Name : fliQ (Bcep18194_A3220)
Accession : YP_367466.1
Strain :
Genome accession: NC_007510
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 54568 - 54840 bp
Length : 273 bp
Strand : -
Note : with proteins FliP and FliR forms the core of the central channel in the flagella export apparatus

DNA sequence :
ATGACGCCCGAACAAGTGATGACCCTGGCGCACCAGGCGATGATGGTCGGCCTGCTGCTGGCCGCCCCGCTGCTGCTGGT
CGCGCTCGTGGTCGGCCTCGTCGTGAGCCTGTTCCAGGCCGCGACGCAGATCAACGAATCGACGCTGTCGTTCATCCCGA
AGCTGCTCGCGGTCGCCGTGACGCTCGTGATCGCCGGCCCGTGGATGATGACGACGATGCTCGACTACCTGCGGCAGACG
CTGCTGCACGTCGCGACGCTCGGCGTCGGCTGA

Protein sequence :
MTPEQVMTLAHQAMMVGLLLAAPLLLVALVVGLVVSLFQAATQINESTLSFIPKLLAVAVTLVIAGPWMMTTMLDYLRQT
LLHVATLGVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 0.010 44
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 0.010 44
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 0.010 44
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 0.006 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_367466.1 flagellar biosynthesis protein FliQ VFG2495 Protein 6e-20 86
fliQ YP_367466.1 flagellar biosynthesis protein FliQ VFG2339 Protein 9e-12 67